y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.007G134300.1
FamilyGH116
Protein PropertiesLength: 956 Molecular Weight: 107235 Isoelectric Point: 6.5722
ChromosomeChromosome/Scaffold: 07 Start: 33213666 End: 33224001
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1165368980
  GRFLYLEGVEYIMWCTYDVHFYASFALLELFPRIELNIQRDFARAVLCEDGRKVKFLAEGNWGIRKVYGAVPHDLGTHDPWYEMNAYNIHDTSKWKDLNP
  KFVLQVYRDFAATGDLQFGIDVWPAVRAAMEYMDQFDRDRDGLIENDGFPDQTYDTWTVHGVSTYCGCLWLAALQAAAAMALELGDRDFAEICKRKFLKA
  KPAFEEKLWNGSYFNYDSGSSGNSKSIQADQLAGQWYTASSGLPSLFEDFKIKSALRKVYDFNVMKVKGGRMGAVNGMHPNGKVDDTCMQSREVWTGVTY
  GVAATMILAGMEEEAFTTAEGIFLAGWSEDGYGYWFQTPEAWTMDGHYRSLMYMRPLAIWGMQ
Full Sequence
Protein Sequence     Length: 956     Download
MVSGNIFHCR KSSWPPEEYI SKSTLLLFDY DSSAPPEQAW RRRLNSHANL LKEFRVTFME    60
AIKMVRLGIR IWSYVREEAS HGRKAPIDPF TRESCKPSAS QGVPLGGMGS GSISRGFRGE    120
FRQWQIIPSL CEASPVMANQ FSIFISREGG NKKFSSVLAP GQHEGLGSTR KPDDQGISSW    180
GWNLSGQHST YHALFPRAWT VYDGEPDPEL KISCRQISPF VPHNYRESSL PAAVFVYTLV    240
NAGKERAKVS LLFTWANSIG GSSHLSGDHV NEPFQTEDGV SGVLLYHKTA KGNPPVTFSI    300
AACETQNVSV SVLPSFGLSE GSSITAKGMW SKMVKDGQFD QENFNSGPSM PSSPGETLCA    360
AVAASAWVEP HGKCTVAFSL AWSSPKVKFV KGCTFNRRYT KFYGTSDKAA VDLAHDALTH    420
YSRWEEEIEK WQNPILKDET LPEWYKFTLF NELYFLVAGG TIWIDSPLLS SSMPNDQDQV    480
RELENAGVKE TEDKINGRKR TVVMRTTDST YESTTSTGHN CVDEKLYGHD NDDDVGRFLY    540
LEGVEYIMWC TYDVHFYASF ALLELFPRIE LNIQRDFARA VLCEDGRKVK FLAEGNWGIR    600
KVYGAVPHDL GTHDPWYEMN AYNIHDTSKW KDLNPKFVLQ VYRDFAATGD LQFGIDVWPA    660
VRAAMEYMDQ FDRDRDGLIE NDGFPDQTYD TWTVHGVSTY CGCLWLAALQ AAAAMALELG    720
DRDFAEICKR KFLKAKPAFE EKLWNGSYFN YDSGSSGNSK SIQADQLAGQ WYTASSGLPS    780
LFEDFKIKSA LRKVYDFNVM KVKGGRMGAV NGMHPNGKVD DTCMQSREVW TGVTYGVAAT    840
MILAGMEEEA FTTAEGIFLA GWSEDGYGYW FQTPEAWTMD GHYRSLMYMR PLAIWGMQYA    900
RNRPKAILEA PKINIMDRIH LSPVIGGFSH HNETGVRKIA TKARCFSNSV FHCAC*        960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3408GDB10.009604694102+
COG4354COG43543.0e-28102465372+
pfam12215GBA2_N2.0e-59102424332+
COG4354COG43546.0e-73533902391+
pfam04685DUF6086.0e-159536899368+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEEC67156.1019551974hypothetical protein OsI_34005 [Oryza sativa Indica Group]
RefSeqNP_189060.2019551950catalytic/ glucosylceramidase [Arabidopsis thaliana]
RefSeqXP_002285674.1019551978PREDICTED: similar to catalytic [Vitis vinifera]
RefSeqXP_002303825.1019551966predicted protein [Populus trichocarpa]
RefSeqXP_002518119.1019551968conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7798602796789560
HO7798601605206790
HO7798601034195210
HO7854393262085310
HO785439491331800.0000000000006
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)