y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.007G153100.1
FamilyGT41
Protein PropertiesLength: 930 Molecular Weight: 103466 Isoelectric Point: 6.0696
ChromosomeChromosome/Scaffold: 07 Start: 37579293 End: 37611303
DescriptionTetratricopeptide repeat (TPR)-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT413628610
  IKPNFSQSLNNLGVVYTVQGKMDAAASMIEKAIIANPTYAEAYNNLGVLYRDAGDISLAINAYEQCLKIDPDSRNAGQNRLLAMNYIDEGNDDKLFEAHR
  DWGRRFMRLYSQFTSWDNSKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYTNYKVIVYSAVVKADAKTSRFREKVVKKGGLWRDIYGTEEKKVADMV
  REDQVDILVELTGHTANNKLGMMACRPAPVQVTWIGYPNTTGLPTIDYRITDSQADPPETKQKHVEELVRLPDCFLCYTPSPEAGPICPTPALSNGFVTF
  GSFNNLAKITPKVLRVWARILCAIPNSRLVVKCKPFCCDSVRQRFLSRLENLGLEALRVDLLPLILLNHDHMQAYSLMDISLDTFPYAGTTTTCESLYMG
  VPCVTMAGSVHAHNVGVSLLSKVGLGHLIAKNEDEYEKLALKLASDVSALQKLRMSLRELMSKSPLCDGAKFIRGLESTYRQMWRRYCKGDVPALKCMEL
Full Sequence
Protein Sequence     Length: 930     Download
MAWVEDKDGD NGRENKLVGE NGFLKVTERS SDGSVGDVGS VSKRCEGKGD VSYANILRSR    60
NKFEDALALY ERVLVDDGGN VEALIGKGIC LQMQNVGRLA FESFNEAIRL DPQNACALTH    120
CGILYKDEGR LMEAAESYQK ALQVDPSYKA AAECLAIVLT DIGTNIKLAG NTQEGIQKYF    180
EALKIDPHYA PAYYNLGVVY SEMMQYDMAL NFYEKAALER PMYAEAYCNM GVIYKNRGDL    240
EAAITCYERC LAVSPNFEIA KNNMAIALTD LGTKVKLEGD INRGVAFYKK ALYYNWHYAD    300
AMYNLGVAYG EMLKFDMAIV FYELAFHFNP HCAEACNNLG VIYKDRDNLD KAVECYQLAL    360
GIKPNFSQSL NNLGVVYTVQ GKMDAAASMI EKAIIANPTY AEAYNNLGVL YRDAGDISLA    420
INAYEQCLKI DPDSRNAGQN RLLAMNYIDE GNDDKLFEAH RDWGRRFMRL YSQFTSWDNS    480
KDPERPLVIG YVSPDYFTHS VSYFIEAPLV YHDYTNYKVI VYSAVVKADA KTSRFREKVV    540
KKGGLWRDIY GTEEKKVADM VREDQVDILV ELTGHTANNK LGMMACRPAP VQVTWIGYPN    600
TTGLPTIDYR ITDSQADPPE TKQKHVEELV RLPDCFLCYT PSPEAGPICP TPALSNGFVT    660
FGSFNNLAKI TPKVLRVWAR ILCAIPNSRL VVKCKPFCCD SVRQRFLSRL ENLGLEALRV    720
DLLPLILLNH DHMQAYSLMD ISLDTFPYAG TTTTCESLYM GVPCVTMAGS VHAHNVGVSL    780
LSKVGLGHLI AKNEDEYEKL ALKLASDVSA LQKLRMSLRE LMSKSPLCDG AKFIRGLEST    840
YRQMWRRYCK GDVPALKCME LLQQHVSTSD PTNNNGESTR NVNLSEGSPG SVMANGFSLT    900
QPLKPNVHSC EENGGSLNHN SKQGMVGSS*                                     960
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13844Glyco_transf_415.0e-21487636151+
COG0457NrfG4.0e-21176443276+
pfam13844Glyco_transf_412.0e-25659845187+
COG3914Spy6.0e-97316848562+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
Swiss-ProtO82039019241929SPY_PETHY RecName: Full=Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY; AltName: Full=PhSPY
RefSeqXP_002281883.1019161914PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308458.1019241931predicted protein [Populus trichocarpa]
RefSeqXP_002323412.1018981903predicted protein [Populus trichocarpa]
RefSeqXP_002530535.1019211924o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1w3b_B5e-368441637388A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B6e-265537475380A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B2e-2119643239268A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B8e-1755312143386A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
PDB1w3b_B0.00000000000331445248211A Chain A, The Superhelical Tpr Domain Of O-linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7812093614928520
HO7812091183925090
DY2954084014298260
HO781209692112770.00006
HO781209583293847.4
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_058_00216.4.161.321Aquca_058_00216.4.161.321Aquca_058_00216.3.387.547Aquca_058_00216.3.387.547Aquca_058_00216.2
Aquca_058_00216.1.601.761Aquca_058_00216.1.601.761Aquca_072_00077.2Aquca_072_00077.3Aquca_072_00077.1
Arabidopsis lyrata896453.457.745896453.457.745478494
Arabidopsis thalianaAT3G04240.1.457.745AT3G04240.1.457.745AT3G11540.1AT3G11540.2
Brachypodium distachyonBradi3g43577.3.610.769Bradi3g43577.3.610.769Bradi3g43577.2Bradi3g43577.1Bradi5g06647.1.621.781
Bradi5g06647.1.621.781Bradi2g58616.1.592.750Bradi2g58616.1.592.750Bradi3g42910.1
Brassica rapaBra040144.586.743Bra040144.586.743Bra001408Bra034832
Carica papayaevm.model.supercontig_51.46.234.522evm.model.supercontig_51.46.234.522
Capsella rubellaCarubv10012900m.457.745Carubv10012900m.457.745Carubv10013012mCarubv10012928m
Chlamydomonas reinhardtiig13482.t1
Citrus clementinaCiclev10018711m.453.741Ciclev10018711m.453.741Ciclev10011210mCiclev10011021m
Citrus sinensisorange1.1g003557m.291.579orange1.1g003557m.291.579orange1.1g002729m.402.690orange1.1g002729m.402.690orange1.1g002431m.402.690
orange1.1g002431m.402.690orange1.1g005626morange1.1g005594morange1.1g004753morange1.1g007075m
orange1.1g002273morange1.1g003891morange1.1g002443morange1.1g002441morange1.1g002438m
orange1.1g006937morange1.1g007634m
Cucumis sativusCucsa.027630.1.563.753Cucsa.027630.1.563.753Cucsa.083560.1
Eucalyptus grandisEucgr.L00641.1.550.718Eucgr.L00641.1.550.718Eucgr.K02568.1
Fragaria vescamrna16720.1-v1.0-hybrid.551.739mrna16720.1-v1.0-hybrid.551.739mrna15637.1-v1.0-hybrid
Glycine maxGlyma10g31190.2Glyma10g31190.1.468.756Glyma10g31190.1.468.756Glyma20g36330.1.468.756Glyma20g36330.1.468.756
Glyma20g36330.2Glyma19g38241.2Glyma19g38241.1Glyma03g35610.3Glyma03g35610.2
Glyma02g36210.4Glyma02g36210.3Glyma10g08710.1
Gossypium raimondiiGorai.011G150500.2.480.766Gorai.011G150500.2.480.766Gorai.011G150500.1.481.772Gorai.011G150500.1.481.772Gorai.011G150500.3
Gorai.013G189100.3.376.564Gorai.013G189100.3.376.564Gorai.013G189100.2.571.758Gorai.013G189100.2.571.758Gorai.013G189100.1.571.758
Gorai.013G189100.1.571.758Gorai.011G150500.5.520.693Gorai.011G150500.5.520.693Gorai.011G150500.4.520.693Gorai.011G150500.4.520.693
Gorai.007G367900.2Gorai.007G367900.1Gorai.002G238200.2Gorai.002G238200.1
Linum usitatissimumLus10003576.450.737Lus10003576.450.737Lus10004779.456.744Lus10004779.456.744Lus10003113.456.744
Lus10003113.456.744Lus10021336Lus10017009
Malus domesticaMDP0000233292.459.747MDP0000233292.459.747MDP0000119499MDP0000212192MDP0000846748
Manihot esculentacassava4.1_001015m.583.740cassava4.1_001015m.583.740cassava4.1_002695m.313.473cassava4.1_002695m.313.473cassava4.1_002691m.313.473
cassava4.1_002691m.313.473cassava4.1_001021m.581.740cassava4.1_001021m.581.740cassava4.1_001222mcassava4.1_001239m
cassava4.1_001390m
Medicago truncatulaMedtr1g079510.2.224.512Medtr1g079510.2.224.512Medtr1g079510.1.466.754Medtr1g079510.1.466.754
Mimulus guttatusmgv1a000777m.468.756mgv1a000777m.468.756mgv1a000982m.534.691mgv1a000982m.534.691mgv1a000971m
Oryza sativaLOC_Os01g68680.1.495.747LOC_Os01g68680.1.495.747LOC_Os02g28830.1.255.415LOC_Os02g28830.1.255.415LOC_Os08g44510.1
Panicum virgatumPavirv00063187m.616.777Pavirv00063187m.616.777Pavirv00007611mPavirv00052192m
Physcomitrella patensPp1s263_4V6.1.478.766Pp1s263_4V6.1.478.766Pp1s177_132V6.1.476.764Pp1s177_132V6.1.476.764Pp1s346_18V6.1
Pp1s456_4V6.1Pp1s150_16V6.1
Phaseolus vulgarisPhvul.007G119800.1.469.757Phvul.007G119800.1.469.757Phvul.001G192300.2Phvul.001G192300.1Phvul.007G153100.2
Picea abiesMA_76964g0020.246.533MA_76964g0020.246.533MA_247226g0010.309.469MA_247226g0010.309.469MA_869746g0010
MA_475186g0010MA_261690g0010
Populus trichocarpaPotri.013G051400.7.84.372Potri.013G051400.7.84.372Potri.013G051400.6.224.512Potri.013G051400.6.224.512Potri.013G051400.5
Potri.013G051400.4.463.751Potri.013G051400.4.463.751Potri.013G051400.3.463.751Potri.013G051400.3.463.751Potri.013G051400.2.463.751
Potri.013G051400.2.463.751Potri.013G051400.1.463.751Potri.013G051400.1.463.751Potri.019G025600.5.224.512Potri.019G025600.5.224.512
Potri.019G025600.2.459.747Potri.019G025600.2.459.747Potri.019G025600.1.459.747Potri.019G025600.1.459.747Potri.019G025600.6.213.376
Potri.019G025600.6.213.376Potri.019G025600.4.417.580Potri.019G025600.4.417.580Potri.019G025600.3.478.641Potri.019G025600.3.478.641
Potri.006G208900.1Potri.016G075700.4Potri.016G075700.3Potri.016G075700.1Potri.016G075700.2
Potri.006G208900.3Potri.006G208900.2
Prunus persicappa000862m.459.747ppa000862m.459.747ppa001075m
Ricinus communis29680.m001749.589.74729680.m001749.589.74727556.m00005030032.m00047548742.m000013
Setaria italicaSi016363mSi016197m.619.779Si016197m.619.779Si000265m.480.641Si000265m.480.641
Si013329mSi013225m
Selaginella moellendorffii143846.391.643143846.391.643159012
Sorghum bicolorSb04g019560.1.619.779Sb04g019560.1.619.779Sb07g024110.1
Thellungiella halophilaThhalv10020104mThhalv10020000m.431.719Thhalv10020000m.431.719Thhalv10019996m.457.745Thhalv10019996m.457.745
Thhalv10020052mThhalv10020017m
Vitis viniferaGSVIVT01026359001.593.754GSVIVT01026359001.593.754GSVIVT01033891001
Volvox carteriVocar20006483m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)