y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.007G160100.1
FamilyPL1
Protein PropertiesLength: 369 Molecular Weight: 41013.5 Isoelectric Point: 8.0177
ChromosomeChromosome/Scaffold: 07 Start: 38715140 End: 38717984
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL11002790
  IVFEVSGTIHLSSYLNVSSHKTIDGRGQRIKLTGKGLRLKECEHVIICNLEFEGGRGHDVDAIQIKPNSKHIWIDRCTLADYDDGLIDITRESTDITISR
  CHFLQHDKTILIGADPSHIDDRCMRVTIHHCFFNGTRQRHPRVRFAKVHLYNNYIRNWGIYAACAGVEAQIFSQHNIYEA
Full Sequence
Protein Sequence     Length: 369     Download
MGNAHGHRHR KHPNSVPPPH KYDHPPPFPT PPPPIANSSM LSLPYTHVDT TLRALAAQAE    60
GFGRFAVGGL HGPLHRVTSL ADDGPGSLRE ACRGKEPLWI VFEVSGTIHL SSYLNVSSHK    120
TIDGRGQRIK LTGKGLRLKE CEHVIICNLE FEGGRGHDVD AIQIKPNSKH IWIDRCTLAD    180
YDDGLIDITR ESTDITISRC HFLQHDKTIL IGADPSHIDD RCMRVTIHHC FFNGTRQRHP    240
RVRFAKVHLY NNYIRNWGIY AACAGVEAQI FSQHNIYEAG QKKVAFKYLT EKAADKEVGT    300
SGIIRSEGDL FLNGAEPGLM AENGGCKMFH PSEHYPSWTV EAPTDDLKHI LHHCTGWQSV    360
 ARPADKAL*                                                           420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00544Pec_lyase_C1.0e-3895275201+
COG3866PelB2.0e-5167350303+
smart00656Amb_all2.0e-65114280179+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK93648.1013681383unknown [Populus trichocarpa]
GenBankABK96132.1013681386unknown [Populus trichocarpa]
RefSeqXP_002277576.1013671370PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002309435.10423684330predicted protein [Populus trichocarpa]
RefSeqXP_002323433.10423684330predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B1e-394931515307A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A1e-394931515307A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1vbl_A5e-27116277130330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB3zsc_A7e-266728422239A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB3vmw_A8e-249634346300A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY275282327403650
DW066041301643640
DY289690312373450
JG177860304603630
JG223264280423210
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00219.1.467.641Aquca_027_00219.1.467.641Aquca_027_00219.1.123.302Aquca_027_00219.1.123.302Aquca_027_00219.2.123.302
Aquca_027_00219.2.123.302Aquca_027_00219.3Aquca_027_00219.2.467.633Aquca_027_00219.2.467.633
Arabidopsis lyrata485935478272
Arabidopsis thalianaAT3G55140.1AT3G55140.2AT3G09540.1
Brachypodium distachyonBradi1g22147.1Bradi2g54350.1
Brassica rapaBra029773Bra014772
Capsella rubellaCarubv10014016mCarubv10017857mCarubv10017611m
Citrus clementinaCiclev10012162mCiclev10032073mCiclev10032345mCiclev10012161mCiclev10011951m
Citrus sinensisorange1.1g016742morange1.1g016766morange1.1g017111morange1.1g017716morange1.1g020048m
orange1.1g020121morange1.1g022635morange1.1g023514morange1.1g024841m
Cucumis sativusCucsa.065830.2Cucsa.065830.1
Eucalyptus grandisEucgr.J01160.1Eucgr.A01218.1Eucgr.A01218.2Eucgr.J01160.2
Fragaria vescamrna18180.1-v1.0-hybridmrna23375.1-v1.0-hybrid
Glycine maxGlyma20g38490.1Glyma10g05290.2Glyma13g19670.2
Gossypium raimondiiGorai.011G245200.2Gorai.011G245200.1Gorai.006G176400.1
Linum usitatissimumLus10030313Lus10003307Lus10025290Lus10024439
Malus domesticaMDP0000302815MDP0000319235MDP0000259620MDP0000215346MDP0000196711
MDP0000322627
Manihot esculentacassava4.1_010014mcassava4.1_030620m
Mimulus guttatusmgv1a009885mmgv1a008720m
Oryza sativaLOC_Os01g62000.1LOC_Os01g36620.1
Panicum virgatumPavirv00008711mPavirv00047085mPavirv00064103m
Physcomitrella patensPp1s37_38V6.3Pp1s37_38V6.4Pp1s37_38V6.2Pp1s37_38V6.1
Phaseolus vulgarisPhvul.007G009300.1
Picea abiesMA_10426401g0010
Populus trichocarpaPotri.006G214400.1Potri.016G080600.1Potri.008G048600.1
Prunus persicappa008409mppa007270m
Ricinus communis29690.m00040929469.m000051
Setaria italicaSi004466mSi010447m
Selaginella moellendorffii93746412910
Sorghum bicolorSb03g039150.1Sb08g004905.1
Thellungiella halophilaThhalv10020972mThhalv10010534m
Vitis viniferaGSVIVT01025593001GSVIVT01005974001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)