y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.007G221000.1
FamilyGT57
Protein PropertiesLength: 536 Molecular Weight: 61194.3 Isoelectric Point: 9.321
ChromosomeChromosome/Scaffold: 07 Start: 46037098 End: 46045937
DescriptionALG6, ALG8 glycosyltransferase family
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT57285270
  ATCIKVLLFPAYRSTDFEVHRNWLALTHSLPLSQWYFDETSPWTLDYPPFFAYYERFLSIFAHLIDPQIVHLQEGLNYSSNKVVYFQRVTVILSDLSLLY
  GVYRLTRNLDSKKQKLIWSLIIWSPMLFIVDHVHFQYNGFLIGILLISLSYLEEGRDLLGGCIFAVLLCFKHLFAVAAPVYFIYLLRHYVWGGMIRGFSR
  LLIMGGVVTAVFASAFGPFFHLGQIQQVIRRLFPFGRGLCHAYWAPNFWVFYIMADKGLAFILRKLGFNIQMPAASFTAGLVGDSSPFSVLPKITPSVTF
  IMVLLALSPCLFKAWKNPKPQMIIRWIAYAYTCGFLFGWHVHEKASLHFVIPLAVVAAQAPEDARHYFLLSIVSCYSIFPLLFEAQEYPIKVLLLLLHSI
  LMWLGFSAQFNAGAETARTPSTNSKKKADEFGSEGSSGETVKKGFVIGWSERIYLIGLVVVEIWGQILHPLILGDKFAFAPLMLISIYCAFGIMYSWIWQ
Full Sequence
Protein Sequence     Length: 536     Download
MGKEKISFKE VHHSHSPKTT LWWFFLVATC IKVLLFPAYR STDFEVHRNW LALTHSLPLS    60
QWYFDETSPW TLDYPPFFAY YERFLSIFAH LIDPQIVHLQ EGLNYSSNKV VYFQRVTVIL    120
SDLSLLYGVY RLTRNLDSKK QKLIWSLIIW SPMLFIVDHV HFQYNGFLIG ILLISLSYLE    180
EGRDLLGGCI FAVLLCFKHL FAVAAPVYFI YLLRHYVWGG MIRGFSRLLI MGGVVTAVFA    240
SAFGPFFHLG QIQQVIRRLF PFGRGLCHAY WAPNFWVFYI MADKGLAFIL RKLGFNIQMP    300
AASFTAGLVG DSSPFSVLPK ITPSVTFIMV LLALSPCLFK AWKNPKPQMI IRWIAYAYTC    360
GFLFGWHVHE KASLHFVIPL AVVAAQAPED ARHYFLLSIV SCYSIFPLLF EAQEYPIKVL    420
LLLLHSILMW LGFSAQFNAG AETARTPSTN SKKKADEFGS EGSSGETVKK GFVIGWSERI    480
YLIGLVVVEI WGQILHPLIL GDKFAFAPLM LISIYCAFGI MYSWIWQLIS IVKSL*        540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03155Alg6_Alg84.0e-10026526516+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI16712.102053418471unnamed protein product [Vitis vinifera]
RefSeqNP_181994.50125323505transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
Swiss-ProtO805050124143405ALG8_ARATH RecName: Full=Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase; AltName: Full=Dolichyl-P-Glc:Glc1Man9GlcNAc2-PP-dolichyl glucosyltransferase; AltName: Full=Asparagine-linked glycosylation protein 8 homolog
RefSeqXP_002269114.102053418531PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002521523.10105347492dolichyl glycosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
2139
111130
143157
162179
191213
228250
288310
325342
349368
393412
419441
504526
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV2676292532775290
GR8412992391313690
EY0984033152205340
FS343913228622890
FG3446372291914190
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00352.1
Arabidopsis lyrata903892
Arabidopsis thalianaAT2G44660.1
Brachypodium distachyonBradi3g52040.1
Brassica rapaBra004854
Carica papayaevm.model.supercontig_50.144
Capsella rubellaCarubv10023047m
Chlamydomonas reinhardtiiCre09.g414250.t1.3.19.125Cre09.g414250.t1.3.178.595Cre09.g414250.t1.3.178.595Cre09.g414250.t1.3.19.125
Citrus clementinaCiclev10014906m
Citrus sinensisorange1.1g019776morange1.1g026008morange1.1g009885m
Cucumis sativusCucsa.362250.1
Eucalyptus grandisEucgr.E01703.1
Fragaria vescamrna03056.1-v1.0-hybrid
Glycine maxGlyma08g10420.1Glyma05g27431.2Glyma05g27431.1
Gossypium raimondiiGorai.003G062300.1
Linum usitatissimumLus10043344Lus10019495
Malus domesticaMDP0000238047
Manihot esculentacassava4.1_005358m
Medicago truncatulaMedtr5g077540.1
Mimulus guttatusmgv1a004526m
Oryza sativaLOC_Os02g46320.1
Panicum virgatumPavirv00056060mPavirv00065643m
Physcomitrella patensPp1s34_140V6.1
Phaseolus vulgarisPhvul.007G221000.2
Picea abiesMA_10429975g0010MA_7890741g0010
Populus trichocarpaPotri.014G053200.1
Prunus persicappa016151mppa004246m
Ricinus communis29634.m002078.26.16329634.m002078.26.16329634.m002078.164.48529634.m002078.164.485
Setaria italicaSi016919m
Selaginella moellendorffii45405.175.35645405.175.356
Sorghum bicolorSb04g031440.1
Thellungiella halophilaThhalv10001410m
Vitis viniferaGSVIVT01018341001
Volvox carteriVocar20011939m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny