y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.007G250500.1
FamilyCE1
Protein PropertiesLength: 286 Molecular Weight: 31965.2 Isoelectric Point: 6.5973
ChromosomeChromosome/Scaffold: 07 Start: 48937987 End: 48943074
DescriptionS-formylglutathione hydrolase
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE1252810
  SPTLGCSMNFHIYFPPSPSPSHKFPVLYWLSGLTCTDENFIVKSGAQRAAAAEGIALVAPDTSPRGLNVEGEADSWDLGVGAGFYVNATQEKWKNWRMYD
  YIVKELPKLLSDNFPQLETSKASIFGHSMGGHGALTIFLKNQDKYKSVSAFAPIANPINCPWGQKAFTNYLGDKKSDWEEYDATCLVTKFPNVSSSILID
  QGEDDKFLPDQLLPNKFEEACRKANVPLLLRFQPGYDHLYYFIATFIDDHIQHHAQA
Full Sequence
Protein Sequence     Length: 286     Download
METKPTEISS GKMFGGYNKR FKHFSPTLGC SMNFHIYFPP SPSPSHKFPV LYWLSGLTCT    60
DENFIVKSGA QRAAAAEGIA LVAPDTSPRG LNVEGEADSW DLGVGAGFYV NATQEKWKNW    120
RMYDYIVKEL PKLLSDNFPQ LETSKASIFG HSMGGHGALT IFLKNQDKYK SVSAFAPIAN    180
PINCPWGQKA FTNYLGDKKS DWEEYDATCL VTKFPNVSSS ILIDQGEDDK FLPDQLLPNK    240
FEEACRKANV PLLLRFQPGY DHLYYFIATF IDDHIQHHAQ ALSLN*                   300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0657Aes0.0002120268172+
pfam00756Esterase7.0e-5025275263+
COG0627COG06271.0e-741284313+
TIGR02821fghA_ester_D1.0e-1238282276+
PLN02442PLN0244201284284+
Gene Ontology
GO TermDescription
GO:0004091carboxylesterase activity
GO:0006508proteolysis
GO:0008236serine-type peptidase activity
GO:0016023cytoplasmic membrane-bounded vesicle
GO:0018738S-formylglutathione hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACJ11734.1012841284S-formylglutathione hydrolase [Gossypium hirsutum]
GenBankACJ84789.1062857285unknown [Medicago truncatula]
GenBankACU19052.1012851285unknown [Glycine max]
RefSeqXP_002284489.1012841284PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002308013.1012701270esterase d, s-formylglutathione hydrolase [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3fcx_B072835281A Chain A, Crystal Structure Of Human Esterase D
PDB3fcx_A072835281A Chain A, Crystal Structure Of Human Esterase D
PDB3s8y_A082837279A Chain A, Bromide Soaked Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica
PDB3i6y_B082837279A Chain A, Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica
PDB3i6y_A082837279A Chain A, Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO79518228612860
HO77774728522860
FD79472626532670
FF38800128012800
DV15790328412840
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00724.1Aquca_014_00724.3Aquca_014_00724.2
Arabidopsis lyrata903473
Arabidopsis thalianaAT2G41530.1
Brachypodium distachyonBradi2g60400.1
Brassica rapaBra000230Bra004627
Carica papayaevm.model.supercontig_182.15
Capsella rubellaCarubv10023793m
Chlamydomonas reinhardtiiCre03.g158800.t3.1Cre03.g158800.t1.3Cre03.g158800.t2.1
Citrus clementinaCiclev10005572m
Citrus sinensisorange1.1g023324morange1.1g024077m
Eucalyptus grandisEucgr.K02019.2Eucgr.K01713.1Eucgr.K02019.1
Fragaria vescamrna21972.1-v1.0-hybrid
Glycine maxGlyma10g15910.1Glyma02g33350.1
Gossypium raimondiiGorai.002G227600.1Gorai.002G227600.2Gorai.002G227600.3
Linum usitatissimumLus10031051Lus10035437Lus10042038
Malus domesticaMDP0000130742MDP0000878750
Manihot esculentacassava4.1_014031mcassava4.1_013351m
Mimulus guttatusmgv1a011293m
Oryza sativaLOC_Os01g71300.2LOC_Os01g71300.1
Panicum virgatumPavirv00039463mPavirv00031885m
Physcomitrella patensPp1s61_17V6.4Pp1s61_17V6.5Pp1s61_17V6.3Pp1s61_17V6.2Pp1s61_17V6.1
Picea abiesMA_348109g0010
Populus trichocarpaPotri.006G047000.5Potri.006G047000.1Potri.006G047000.2Potri.006G047000.3Potri.006G047000.4
Prunus persicappa009542m
Ricinus communis29840.m000625
Setaria italicaSi001977mSi023477m
Selaginella moellendorffii151094
Sorghum bicolorSb03g045400.1
Thellungiella halophilaThhalv10017045m
Vitis viniferaGSVIVT01033232001
Volvox carteriVocar20000681m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny