y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.007G251100.1
FamilyGT1
Protein PropertiesLength: 463 Molecular Weight: 51887.9 Isoelectric Point: 5.9318
ChromosomeChromosome/Scaffold: 07 Start: 48983188 End: 48984576
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12554381.3e-33
  VEWLDKQEPSSVIYISFGTTTALRDEQIQEIATGLEQSKQKFIWVLRDADKGDIFDGSEAKRYELPEGFEERVEGMGLVVRDWAPQMEILSHGSTGGFMS
  HCGWNSCLESITMGVPIATWAMHSDQPRNAVLVTDVLKVGLVVKDWDQRNALVSASDVEKAVRRLMETEEGDEIRERAVKLKNA
Full Sequence
Protein Sequence     Length: 463     Download
MAFNGDNLPH QNQVVVVLIP FPAQGHLNQL MHLSHLISSH NIPVHYVSTV THIRQATLRH    60
HKSSSTIHFH SFQVPPFVSP PPNPNNPETD FPSHLIPSFE ASTHLQEPVG KLLQSLSSQA    120
KRVIVIHDSL MASVAQDATN MPNVENYTFH CTCAFTTFAF FWEEMGKPPL EAFRVPEFPS    180
LEGCFPTQFI DFIVAQYELQ KFNDGNIYNT SRAIEDPYLE LLNLFSAGKK VWALGPFNPL    240
TVEKKDSIGL RHSCVEWLDK QEPSSVIYIS FGTTTALRDE QIQEIATGLE QSKQKFIWVL    300
RDADKGDIFD GSEAKRYELP EGFEERVEGM GLVVRDWAPQ MEILSHGSTG GFMSHCGWNS    360
CLESITMGVP IATWAMHSDQ PRNAVLVTDV LKVGLVVKDW DQRNALVSAS DVEKAVRRLM    420
ETEEGDEIRE RAVKLKNAIH RSMDEGGGSH MEMASFIAHI TK*                      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02863PLN028636.0e-52205460265+
PLN00164PLN001642.0e-58163453307+
PLN02534PLN025342.0e-599462495+
PLN03007PLN030073.0e-63171461311+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM09513.2014621461AF489873_1 putative glucosyltransferase [Glycine max]
GenBankAAM09516.1014621462AF489876_1 putative glucosyltransferase [Phaseolus lunatus]
GenBankAAM09517.1014621462AF489877_1 putative glucosyltransferase [Phaseolus lunatus]
Swiss-ProtP56725084623454ZOX_PHAVU RecName: Full=Zeatin O-xylosyltransferase; AltName: Full=Zeatin O-beta-D-xylosyltransferase
Swiss-ProtQ9ZSK5014621459ZOG_PHALU RecName: Full=Zeatin O-glucosyltransferase; AltName: Full=Trans-zeatin O-beta-D-glucosyltransferase
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A9.80909e-45164499456A Chain A, Human Beta-Hexosaminidase B
PDB2vch_A9.80909e-45164499456A Chain A, Human Beta-Hexosaminidase B
PDB2vce_A9.80909e-45164499456A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2pq6_A2e-401646011477A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB3hbj_A4.00001e-40224461235453A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG631252465104630
FE7065302681964630
FE7075262641834460
HO7835653071624630
FE7065332262384630
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00739.1Aquca_009_00322.1Aquca_009_00320.1Aquca_009_00319.1Aquca_009_00323.1
Brachypodium distachyonBradi1g18820.1Bradi5g18030.1Bradi2g06130.1Bradi5g18020.1Bradi5g18040.1
Bradi5g18010.1
Carica papayaevm.model.supercontig_182.5
Citrus clementinaCiclev10004886m
Citrus sinensisorange1.1g039436m
Cucumis sativusCucsa.191200.1Cucsa.269020.1Cucsa.269030.1
Eucalyptus grandisEucgr.A02328.1Eucgr.A02326.1Eucgr.A02321.1Eucgr.B02735.1Eucgr.A02320.1
Eucgr.A02318.1Eucgr.A02314.1Eucgr.A02323.1Eucgr.A02308.1Eucgr.A02330.1
Eucgr.A02329.1
Fragaria vescamrna21990.1-v1.0-hybrid
Glycine maxGlyma10g15730.1Glyma02g11653.1.385.490Glyma02g11653.1.385.490Glyma02g32770.1Glyma10g15790.1
Glyma19g31820.2Glyma03g29051.1Glyma02g32020.1
Gossypium raimondiiGorai.002G227900.1
Malus domesticaMDP0000850255MDP0000793268
Manihot esculentacassava4.1_024063mcassava4.1_029572m
Mimulus guttatusmgv1a027163mmgv1a026906mmgv1a022179mmgv1a017976mmgv1a023637m
mgv1a005799mmgv1a024073mmgv1a019962mmgv1a004882mmgv1a005868m
Oryza sativaLOC_Os04g47720.1LOC_Os04g47770.1LOC_Os04g46980.1LOC_Os04g46990.1LOC_Os07g46610.1
LOC_Os04g46970.1
Panicum virgatumPavirv00029796mPavirv00035426mPavirv00007661mPavirv00044408mPavirv00053815m
Pavirv00024885mPavirv00057452mPavirv00068157mPavirv00034673mPavirv00059670m
Pavirv00012261mPavirv00023426mPavirv00031716mPavirv00023425mPavirv00023663m
Pavirv00006748m
Physcomitrella patensPp1s243_16V6.4Pp1s243_16V6.3Pp1s243_16V6.2Pp1s243_16V6.1Pp1s93_74V6.1
Phaseolus vulgarisPhvul.007G251200.1Phvul.007G251000.1Phvul.007G251300.1Phvul.008G103900.1Phvul.001G129900.1
Picea abiesMA_152538g0010MA_10661g0020MA_125120g0010MA_175870g0010MA_658172g0010
MA_9576120g0010MA_10347747g0010
Populus trichocarpaPotri.006G048200.1Potri.016G057300.1Potri.006G047200.1
Prunus persicappa005515m
Ricinus communis29937.m00020729937.m000209
Setaria italicaSi010032mSi010040mSi029740mSi010038mSi012663m
Si010045mSi012135m
Sorghum bicolorSb06g024946.1Sb06g024960.1Sb06g024950.1Sb10g027940.1Sb02g041935.1
Sb06g024970.1Sb06g012280.1Sb06g024930.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)