y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.007G279900.1
FamilyCE10
Protein PropertiesLength: 826 Molecular Weight: 90602.8 Isoelectric Point: 6.7617
ChromosomeChromosome/Scaffold: 07 Start: 51635688 End: 51645133
Descriptionacylaminoacyl-peptidase-related
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE105868091.3e-30
  KSDACDPLIVVLHGGPHSVLLSSFSKPLAYLASVGYSLLIVNYRGSIGFGEEALQSLPGKAGSQDVNDVLTAIDHVIDLGLASPSKIAVLGGSHGGFLTT
  HLIGQAPEKFVAAAARNPVCNLALMVGTTDIPDWCYVETYGTKGKDKFTEAPSAEDLTLFYSKSPISHLSKAKTPTLFLLGAQDLRVPISTGLQYARALR
  EKGVPTKVIVFPNDVHGIERPQSD
Full Sequence
Protein Sequence     Length: 826     Download
MESKMFGSRS SVGNWCGRVA ASPNYLFLPI QLPIPIPNPI LHCSRSSLQL TARRRFSFSP    60
VPPMDDEHQA KEQEEYASHS DHLHQFTAIP TIDKAWLFNS HTIHMPSQAM FCVSQPNLLT    120
NKRKKSIVSA SLLRQTDATV AFHWTPFPIE FSGVSAMLPS PSASKLLIVR NPESEGPCRF    180
EIWSSSQLEK EFHVPQSKHG SVYTDGWFEG ISWNLNETCI AYVAEEPAPA KPTFNDLGGY    240
QKSGSSDKDC GTWKAQGEWE EEWGETYAGK RQPALFVIDI TSGEVQAVKG IDKSLSIGQV    300
VWAPTIEGSV QYLVFVGWSF ETRKLGIKYC YNRPCALYAV KAPHYESKAN ETETYSTEDV    360
QAVNLTQTIS SAFYPRFSPD GKFLVFVSAR SSVDSGAHSA TNSLHRIDWP KDMKLYQSSK    420
IHEVIPVVLF AEDGSFPGLY CSNILSDPWL SDGHSLVVAS VWHSNQVLLS INVLSGEILR    480
ITPANSNFSW SLLTLDGNNI LAVSSSPVDV PQIKYGAIVK NTTNNEEWSW SDVSNPIFKC    540
SDKVRSSISS LTSSIMKIPV KDVSESLTKG ASQPFEAIFV SSKTKKSDAC DPLIVVLHGG    600
PHSVLLSSFS KPLAYLASVG YSLLIVNYRG SIGFGEEALQ SLPGKAGSQD VNDVLTAIDH    660
VIDLGLASPS KIAVLGGSHG GFLTTHLIGQ APEKFVAAAA RNPVCNLALM VGTTDIPDWC    720
YVETYGTKGK DKFTEAPSAE DLTLFYSKSP ISHLSKAKTP TLFLLGAQDL RVPISTGLQY    780
ARALREKGVP TKVIVFPNDV HGIERPQSDF ESYLNIAIWF NKYCK*                   840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1505COG15051.0e-10579791216+
pfam12697Abhydrolase_68.0e-11594807216+
pfam00326Peptidase_S97.0e-37608823219+
COG1506DAP21.0e-43592825234+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008152metabolic process
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI26348.107382570822unnamed protein product [Vitis vinifera]
RefSeqNP_193193.207382521763acylaminoacyl-peptidase-related [Arabidopsis thaliana]
RefSeqXP_002284013.107382521770PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002284016.107382521760PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002517031.107082518771acylamino-acid-releasing enzyme, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hxf_B8e-18592802379579A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB4hxe_B8e-18592802379579B Chain B, Pyrococcus Horikoshii Acylaminoacyl Peptidase (uncomplexed)
PDB4hxg_L2e-17592802379579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_K2e-17592802379579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_J2e-17592802379579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7820172715618260
HO7975573095358260
FF5458422654927560
HO7893632291093370
CV5438582394306680
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2
Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)