y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.008G033000.1
FamilyGH81
Protein PropertiesLength: 668 Molecular Weight: 75303.4 Isoelectric Point: 7.6872
ChromosomeChromosome/Scaffold: 08 Start: 2728468 End: 2730923
Descriptionglycosyl hydrolase family 81 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH81246630
  TVLPDPSTYFSPNLLSSPLPTNSFFQNFVIPNGTVPEYFHPYHIQSSNSSLSASYPFLFFTAAVLYQVFVPDLTISASQTYSNAQNRVISSYSDLGVTLD
  IPTSNLRFFLVRGSPFITASVTKPTSLSITTVHTILSLSSYDDNTKFILQLNNTQTWLIYTSSPIYLNHAASQVSSKPFSGIIRIAALPDSNPNNVATLD
  KFSSCYPVSGDAALKKPFRVEYKWQRKRSGDLLMLAHPLHAKLLSHDCNVTVLHDFKYRSVDGDLVGVVGDSWVLETDPIPVTWHSKKGIDKESFGEIIS
  ALNKDVKELNSSAITTQSSYFYGKLVGRAARLALIAEEVSYPKVIPKIRNFLKETIEPWLDGTFKGNAFLYERKWRGLVTKQGSTDSTADFGFGVYNDHH
  FHLGYFIYGIAVLAKIDPAWGKQYKPQAYSLVTDFMNLGQRYNTDYPRLRCFDLYKLHSWASGLTEFEDGRNQESTSEAVNAYYAAALMGLAYGDSRLVD
  TGSTLLALEIRATQTWWHVKVEDNLYEEEFAKDNRIVGILWANKRDSKLWWAPAECRECRLSIQVLPLLPVTETLFFDTVYAKELVEWTLPSLKNKTNVE
  GWKGFTYALQGIYDKTTALKKIRMLTGFDDGNSFSNLLWW
Full Sequence
Protein Sequence     Length: 668     Download
MSQFPFSSSQ TMSSSFLFPQ TQSTVLPDPS TYFSPNLLSS PLPTNSFFQN FVIPNGTVPE    60
YFHPYHIQSS NSSLSASYPF LFFTAAVLYQ VFVPDLTISA SQTYSNAQNR VISSYSDLGV    120
TLDIPTSNLR FFLVRGSPFI TASVTKPTSL SITTVHTILS LSSYDDNTKF ILQLNNTQTW    180
LIYTSSPIYL NHAASQVSSK PFSGIIRIAA LPDSNPNNVA TLDKFSSCYP VSGDAALKKP    240
FRVEYKWQRK RSGDLLMLAH PLHAKLLSHD CNVTVLHDFK YRSVDGDLVG VVGDSWVLET    300
DPIPVTWHSK KGIDKESFGE IISALNKDVK ELNSSAITTQ SSYFYGKLVG RAARLALIAE    360
EVSYPKVIPK IRNFLKETIE PWLDGTFKGN AFLYERKWRG LVTKQGSTDS TADFGFGVYN    420
DHHFHLGYFI YGIAVLAKID PAWGKQYKPQ AYSLVTDFMN LGQRYNTDYP RLRCFDLYKL    480
HSWASGLTEF EDGRNQESTS EAVNAYYAAA LMGLAYGDSR LVDTGSTLLA LEIRATQTWW    540
HVKVEDNLYE EEFAKDNRIV GILWANKRDS KLWWAPAECR ECRLSIQVLP LLPVTETLFF    600
DTVYAKELVE WTLPSLKNKT NVEGWKGFTY ALQGIYDKTT ALKKIRMLTG FDDGNSFSNL    660
LWWIHSR*                                                             720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4934COG49340.00733189173+
COG5498ACF26.0e-5827666703+
pfam03639Glyco_hydro_81021667702+
Gene Ontology
GO TermDescription
GO:0016998cell wall macromolecule catabolic process
GO:0033903endo-1,3(4)-beta-glucanase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB69782.10136673660beta-glucan-binding protein 2 [Medicago truncatula]
GenBankABB69784.101666711665beta-glucan-binding protein 4 [Medicago truncatula]
DDBJBAA11407.10136677665beta-glucan-elicitor receptor [Glycine max]
EMBLCAA71307.10136677665beta-glucan binding protein [Glycine max]
RefSeqXP_002282971.101366765723PREDICTED: hypothetical protein [Vitis vinifera]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE6916552783085850
FF391712228222490
FG893341217202360
ES8165422823035840
ES816542795836615
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01041.1
Arabidopsis lyrata909564
Arabidopsis thalianaAT5G15870.1AT1G18310.1
Brachypodium distachyonBradi4g29390.1
Brassica rapaBra023544Bra008667Bra025916
Carica papayaevm.TU.contig_34602.1evm.model.supercontig_179.46
Capsella rubellaCarubv10000292mCarubv10008525m
Chlamydomonas reinhardtiiCre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714
Citrus clementinaCiclev10011145m
Citrus sinensisorange1.1g042050m
Cucumis sativusCucsa.238220.1Cucsa.238230.1Cucsa.237660.1
Eucalyptus grandisEucgr.I02120.1Eucgr.I02118.1Eucgr.I02113.1Eucgr.L01291.1Eucgr.I02117.1
Eucgr.L01293.1Eucgr.L01292.1Eucgr.L01830.1Eucgr.L01010.1Eucgr.L01290.1
Eucgr.I02115.1Eucgr.I02114.1
Fragaria vescamrna10352.1-v1.0-hybridmrna04398.1-v1.0-hybridmrna25909.1-v1.0-hybridmrna04399.1-v1.0-hybridmrna24770.1-v1.0-hybrid
Glycine maxGlyma19g05550.2Glyma13g07230.2Glyma18g50180.1Glyma18g50220.1Glyma08g26935.1
Glyma13g07220.1Glyma08g27000.1Glyma08g26940.1Glyma08g26980.1Glyma13g07240.2
Glyma13g07210.2.390.614Glyma13g07210.2.390.614Glyma03g04290.1Glyma13g07210.2.22.372Glyma13g07210.2.22.372
Gossypium raimondiiGorai.001G082200.1Gorai.007G368000.1
Linum usitatissimumLus10021987Lus10042525Lus10042526
Malus domesticaMDP0000148377MDP0000314562MDP0000855663MDP0000695045MDP0000199068
MDP0000517518MDP0000206670
Manihot esculentacassava4.1_002382m
Medicago truncatulaAC233685_94.1AC233572_18.1AC233685_92.1AC233572_20.1Medtr7g013170.1
AC233572_21.1AC233572_19.1AC233572_25.1AC233685_93.1AC233572_23.1
AC233572_30.1AC233685_76.1AC233572_29.1AC233685_33.1AC233685_46.1
AC233685_68.1AC233685_75.1AC233685_34.1AC233685_74.1Medtr1g079270.1
Medtr7g112730.1
Mimulus guttatusmgv1a002257m
Oryza sativaLOC_Os09g21210.1
Panicum virgatumPavirv00025146mPavirv00045049mPavirv00057587mPavirv00052228m
Physcomitrella patensPp1s16_374V6.1
Phaseolus vulgarisPhvul.004G049300.1Phvul.008G033100.1Phvul.008G033200.1Phvul.004G049400.1Phvul.004G049200.1
Picea abiesMA_10050955g0010MA_28794g0010MA_18557g0010MA_10435904g0010MA_17399g0010
Populus trichocarpaPotri.004G105300.1
Prunus persicappa001976mppa019057mppa023327mppa025396mppa022822m
ppa018031m
Ricinus communis27469.m00016529980.m00017535080.m000014
Setaria italicaSi029037m
Selaginella moellendorffii10094297501
Sorghum bicolorSb02g023660.1Sb10g001930.1
Thellungiella halophilaThhalv10012764mThhalv10003773m
Vitis viniferaGSVIVT01036466001
Volvox carteriVocar20013899m.72.571Vocar20013899m.72.571
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)