y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.008G033200.1
FamilyGH81
Protein PropertiesLength: 656 Molecular Weight: 73195.1 Isoelectric Point: 5.0358
ChromosomeChromosome/Scaffold: 08 Start: 2756087 End: 2758731
Descriptionglycosyl hydrolase family 81 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH81156510
  TVLPDPSTYFSSNLLSSPLPTNSFFQNYVIPNGSQPEYIHPYLIKSTNSSLSASYPLLLFTTALLYQAFVPDLTISSTQTHSQQQNRVISSFSDLGVTLD
  IPSSNLRFFLSRGSPFITASVTSSTSLSITTLYTILSLSSNNENNTKYTLKLNNTQTWLIYTSSPIHFNHNASEATSKPFSGIIRVAVLPNPNYETILDK
  YSSCYPLLGDATLEEPSRVVYQWQKEGSGDLLMLAHPLHVKLLSNNNNGNVTLLSDFKYRSIDGDLVGVVGDSWILQTDRIPVTWYSNNGVETNSYDEIV
  SALVKDVQALNSSAIGTTSSYFYGKRVGRAARLALIAEEVSFSKVVPTVTDFLKEAIEPWLDGTFEGNGFLYENKWGGLVTKLGSTDSSADFGFGVYNDH
  HYHLGYFLYGIAVLAKIDPEWGQKYKPQVYSLVTDFMNLGQRYNRNYPRLRCFDLYTLHSWAAGVTEFEDGRNQESTSEAVNAYYSAALVGLAYGDSSLV
  ATGSTLVALEILAAQTWWHVKVEDNLYEEEFAKDNRIVGIVWANKRDSKLWWAGADCRECRLGIQVLPLLPITETLFSDADYVKELVEWTFPSLSSEGWK
  GMTYALQGVYDKQTALQNIRTLKGFDDGNSYSNLLWW
Full Sequence
Protein Sequence     Length: 656     Download
MSSSSSFLFP QTQSTVLPDP STYFSSNLLS SPLPTNSFFQ NYVIPNGSQP EYIHPYLIKS    60
TNSSLSASYP LLLFTTALLY QAFVPDLTIS STQTHSQQQN RVISSFSDLG VTLDIPSSNL    120
RFFLSRGSPF ITASVTSSTS LSITTLYTIL SLSSNNENNT KYTLKLNNTQ TWLIYTSSPI    180
HFNHNASEAT SKPFSGIIRV AVLPNPNYET ILDKYSSCYP LLGDATLEEP SRVVYQWQKE    240
GSGDLLMLAH PLHVKLLSNN NNGNVTLLSD FKYRSIDGDL VGVVGDSWIL QTDRIPVTWY    300
SNNGVETNSY DEIVSALVKD VQALNSSAIG TTSSYFYGKR VGRAARLALI AEEVSFSKVV    360
PTVTDFLKEA IEPWLDGTFE GNGFLYENKW GGLVTKLGST DSSADFGFGV YNDHHYHLGY    420
FLYGIAVLAK IDPEWGQKYK PQVYSLVTDF MNLGQRYNRN YPRLRCFDLY TLHSWAAGVT    480
EFEDGRNQES TSEAVNAYYS AALVGLAYGD SSLVATGSTL VALEILAAQT WWHVKVEDNL    540
YEEEFAKDNR IVGIVWANKR DSKLWWAGAD CRECRLGIQV LPLLPITETL FSDADYVKEL    600
VEWTFPSLSS EGWKGMTYAL QGVYDKQTAL QNIRTLKGFD DGNSYSNLLW WIHSR*        660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5498ACF22.0e-51172654518+
pfam03639Glyco_hydro_816.0e-17112655697+
Gene Ontology
GO TermDescription
GO:0016998cell wall macromolecule catabolic process
GO:0033903endo-1,3(4)-beta-glucanase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB69782.1036552660beta-glucan-binding protein 2 [Medicago truncatula]
GenBankABB69784.1046558665beta-glucan-binding protein 4 [Medicago truncatula]
DDBJBAA11407.1016554665beta-glucan-elicitor receptor [Glycine max]
EMBLCAA71307.1016554665beta-glucan binding protein [Glycine max]
RefSeqXP_002282971.10165562723PREDICTED: hypothetical protein [Vitis vinifera]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE6916552783005770
FE6928602214366560
HO6493955321726560
ES8165422912865760
EV2620192473285740
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01041.1
Arabidopsis lyrata909564
Arabidopsis thalianaAT5G15870.1AT1G18310.1
Brachypodium distachyonBradi4g29390.1
Brassica rapaBra023544Bra008667Bra025916
Carica papayaevm.TU.contig_34602.1evm.model.supercontig_179.46
Capsella rubellaCarubv10000292mCarubv10008525m
Chlamydomonas reinhardtiiCre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714
Citrus clementinaCiclev10011145m
Citrus sinensisorange1.1g042050m
Cucumis sativusCucsa.238220.1Cucsa.238230.1Cucsa.237660.1
Eucalyptus grandisEucgr.I02120.1Eucgr.I02118.1Eucgr.I02113.1Eucgr.L01291.1Eucgr.I02117.1
Eucgr.L01293.1Eucgr.L01292.1Eucgr.L01830.1Eucgr.L01010.1Eucgr.L01290.1
Eucgr.I02115.1Eucgr.I02114.1
Fragaria vescamrna10352.1-v1.0-hybridmrna04398.1-v1.0-hybridmrna25909.1-v1.0-hybridmrna04399.1-v1.0-hybridmrna24770.1-v1.0-hybrid
Glycine maxGlyma19g05550.2Glyma13g07230.2Glyma18g50180.1Glyma18g50220.1Glyma08g26935.1
Glyma13g07220.1Glyma08g27000.1Glyma08g26940.1Glyma08g26980.1Glyma13g07240.2
Glyma13g07210.2.390.614Glyma13g07210.2.390.614Glyma03g04290.1Glyma13g07210.2.22.372Glyma13g07210.2.22.372
Gossypium raimondiiGorai.001G082200.1Gorai.007G368000.1
Linum usitatissimumLus10021987Lus10042525Lus10042526
Malus domesticaMDP0000148377MDP0000314562MDP0000855663MDP0000695045MDP0000199068
MDP0000517518MDP0000206670
Manihot esculentacassava4.1_002382m
Medicago truncatulaAC233685_94.1AC233572_18.1AC233685_92.1AC233572_20.1Medtr7g013170.1
AC233572_21.1AC233572_19.1AC233572_25.1AC233685_93.1AC233572_23.1
AC233572_30.1AC233685_76.1AC233572_29.1AC233685_33.1AC233685_46.1
AC233685_68.1AC233685_75.1AC233685_34.1AC233685_74.1Medtr1g079270.1
Medtr7g112730.1
Mimulus guttatusmgv1a002257m
Oryza sativaLOC_Os09g21210.1
Panicum virgatumPavirv00025146mPavirv00045049mPavirv00057587mPavirv00052228m
Physcomitrella patensPp1s16_374V6.1
Phaseolus vulgarisPhvul.004G049300.1Phvul.008G033100.1Phvul.008G033000.1Phvul.004G049400.1Phvul.004G049200.1
Picea abiesMA_10050955g0010MA_28794g0010MA_18557g0010MA_10435904g0010MA_17399g0010
Populus trichocarpaPotri.004G105300.1
Prunus persicappa001976mppa019057mppa023327mppa025396mppa022822m
ppa018031m
Ricinus communis27469.m00016529980.m00017535080.m000014
Setaria italicaSi029037m
Selaginella moellendorffii10094297501
Sorghum bicolorSb02g023660.1Sb10g001930.1
Thellungiella halophilaThhalv10012764mThhalv10003773m
Vitis viniferaGSVIVT01036466001
Volvox carteriVocar20013899m.72.571Vocar20013899m.72.571
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)