y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.008G056500.2
FamilyGT1
Protein PropertiesLength: 465 Molecular Weight: 51992.1 Isoelectric Point: 9.1943
ChromosomeChromosome/Scaffold: 08 Start: 5041564 End: 5049163
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT134090
  IVGTRGDVQPFVAMGKRLQEDGHRVRLATHKNFEDFVLNAGLEFYPLGGDPKVLAGYMVKNKGFLPSGPSEIHIQRNQIKDIINSLLPACQSRYPESNAT
  FKAEAIIANPPAYGHTHVAEYLKVPLHIFFTMPWTPTSEFPHPLSRVKQPIGYRVSYQVVDALIWLGIRDMINEFRKKKLKLKPVTYLSGSYTHPFDVPH
  GYIWSPHLVPKPKDWGHNIDVVGFCFLDLASNFEPPKSLVDWLEEGEKPIYVGFGSLPLQEPEKMTKIIIQALEKTGQRGIINKGWGGLGSLAEQKKSVY
  LLDNCPHDWLFPQCSAVVHHGGAGTTAAGLRAECPTTIVPFFGDQPFWGDRVHARGVGPAPIPVDEFTLDRLVDAIHFMLKPEVKRRAVDLANAMKNEDG
  VLGAVKA
Full Sequence
Protein Sequence     Length: 465     Download
MLIVGTRGDV QPFVAMGKRL QEDGHRVRLA THKNFEDFVL NAGLEFYPLG GDPKVLAGYM    60
VKNKGFLPSG PSEIHIQRNQ IKDIINSLLP ACQSRYPESN ATFKAEAIIA NPPAYGHTHV    120
AEYLKVPLHI FFTMPWTPTS EFPHPLSRVK QPIGYRVSYQ VVDALIWLGI RDMINEFRKK    180
KLKLKPVTYL SGSYTHPFDV PHGYIWSPHL VPKPKDWGHN IDVVGFCFLD LASNFEPPKS    240
LVDWLEEGEK PIYVGFGSLP LQEPEKMTKI IIQALEKTGQ RGIINKGWGG LGSLAEQKKS    300
VYLLDNCPHD WLFPQCSAVV HHGGAGTTAA GLRAECPTTI VPFFGDQPFW GDRVHARGVG    360
PAPIPVDEFT LDRLVDAIHF MLKPEVKRRA VDLANAMKNE DGVLGAVKAF YKHYPDQKSK    420
CEFAKDLATK PKPIHKYFCL RGCFGFSTSS VDTHQPSKEK RKTT*                    480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1819COG18192.0e-305403406+
pfam03033Glyco_transf_282.0e-311143143+
cd03784GT1_Gtf_like4.0e-1221413413+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030259lipid glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABN05866.10145168517Glycosyl transferase, family 28 [Medicago truncatula]
DDBJBAC22617.101447164602UDP-glucose:sterol 3-O-glucosyltransferase [Panax ginseng]
EMBLCBI37267.101447176615unnamed protein product [Vitis vinifera]
RefSeqXP_002301763.10141896513predicted protein [Populus trichocarpa]
RefSeqXP_002521125.101422185606transferase, transferring glycosyl groups, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3h4t_A2e-3354259392A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB3h4i_A2e-3354259392A Chain A, Chimeric Glycosyltransferase For The Generation Of Novel Natural Products
PDB1iir_A5e-2514065391A Chain A, Crystal Structure Of Udp-Glucosyltransferase Gtfb
PDB1rrv_B3e-2334027387A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB1rrv_A3e-2334027387A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT04635233563400
GO88316630313030
CX664063293983900
DV4665572871164020
GT046352323333640.0002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00218.3Aquca_034_00218.2Aquca_034_00218.1Aquca_023_00154.1Aquca_034_00218.4
Aquca_023_00154.3Aquca_023_00154.2Aquca_114_00011.1Aquca_114_00011.2
Arabidopsis lyrata896855473768910517
Arabidopsis thalianaAT3G07020.2AT3G07020.1AT1G43620.3AT1G43620.2AT1G43620.1
AT5G24750.1
Brachypodium distachyonBradi5g01230.1Bradi2g56102.1Bradi3g07997.4Bradi3g07997.3Bradi3g07997.2
Brassica rapaBra001229Bra040355Bra029615Bra020468
Carica papayaevm.model.supercontig_8.181evm.model.supercontig_21.209
Capsella rubellaCarubv10013188mCarubv10013187mCarubv10008593mCarubv10002561m
Chlamydomonas reinhardtiiCre07.g333450.t1.2
Citrus clementinaCiclev10020154mCiclev10011454mCiclev10000559mCiclev10000975m
Citrus sinensisorange1.1g013358morange1.1g006412morange1.1g008369morange1.1g013835morange1.1g047047m
Cucumis sativusCucsa.078450.1Cucsa.140330.2Cucsa.140330.1Cucsa.356970.2Cucsa.078450.2
Cucsa.363720.1
Eucalyptus grandisEucgr.H00810.1Eucgr.B01378.1Eucgr.F02699.1Eucgr.H01372.1Eucgr.B01630.1
Eucgr.F02699.2Eucgr.H01372.2Eucgr.G00612.3Eucgr.G00612.1Eucgr.G00612.2
Fragaria vescamrna16762.1-v1.0-hybridmrna17551.1-v1.0-hybridmrna08139.1-v1.0-hybrid
Glycine maxGlyma03g19751.1Glyma18g28130.2Glyma18g28130.1Glyma18g47490.2Glyma18g47490.1
Glyma02g08940.1Glyma10g36850.2Glyma20g30760.2Glyma20g30760.4Glyma20g30760.3
Glyma09g38830.2Glyma20g30760.6Glyma20g30760.5Glyma02g08940.2Glyma08g19700.2
Gossypium raimondiiGorai.001G184700.2Gorai.001G184700.10Gorai.001G184700.1Gorai.004G058300.2Gorai.004G058300.1
Gorai.004G261100.2Gorai.004G261100.1Gorai.009G254800.4Gorai.009G254800.3Gorai.009G254800.2
Gorai.009G254800.1Gorai.001G184700.3Gorai.009G254800.5Gorai.001G184700.4Gorai.001G184700.5
Gorai.001G184700.7Gorai.001G184700.6Gorai.001G184700.8Gorai.004G261100.3Gorai.008G041600.1
Linum usitatissimumLus10020382Lus10011882Lus10024544Lus10022815Lus10018878
Lus10009556Lus10028572Lus10011883Lus10020381Lus10009557
Malus domesticaMDP0000304346MDP0000278182MDP0000175609MDP0000304996MDP0000152076
MDP0000243097MDP0000771934MDP0000895000
Manihot esculentacassava4.1_004218mcassava4.1_003877mcassava4.1_025328mcassava4.1_014281m
Medicago truncatulaMedtr4g022580.1Medtr7g079430.1Medtr1g098640.2Medtr1g098640.1Medtr1g098640.3
Medtr4g022610.1
Mimulus guttatusmgv1a002910mmgv1a003019mmgv1a022288mmgv1a023756mmgv1a010079m
mgv1a004761mmgv1a005156m
Oryza sativaLOC_Os07g23740.3LOC_Os07g23740.2LOC_Os07g23740.1LOC_Os04g04254.2LOC_Os04g04254.1
LOC_Os01g64750.1LOC_Os04g04240.1LOC_Os02g11940.1
Panicum virgatumPavirv00030954mPavirv00043473mPavirv00043474mPavirv00048943mPavirv00056277m
Pavirv00034065mPavirv00051133m
Physcomitrella patensPp1s90_132V6.1Pp1s245_59V6.1Pp1s110_116V6.1Pp1s159_62V6.1Pp1s281_20V6.1
Pp1s131_65V6.1
Phaseolus vulgarisPhvul.008G056500.1Phvul.010G013800.1Phvul.007G080800.1Phvul.004G093900.3Phvul.004G093900.2
Phvul.004G093900.1Phvul.006G212700.1
Picea abiesMA_84359g0010
Populus trichocarpaPotri.014G178300.1Potri.002G067100.1Potri.002G238600.4Potri.002G238600.2Potri.002G238600.1
Potri.002G067100.2Potri.005G193100.1Potri.002G238600.3Potri.003G021100.2Potri.003G021100.1
Prunus persicappa019814mppa002976mppa002535mppa005311m
Ricinus communis30204.m00179130128.m00900929863.m00104933210.m00003430116.m000381
Setaria italicaSi029583mSi009641mSi009639mSi017298m
Selaginella moellendorffii11051343056026840374515406232
Sorghum bicolorSb06g001270.1Sb03g040980.1Sb06g001270.2Sb02g010030.1Sb04g007366.1
Thellungiella halophilaThhalv10020288mThhalv10005442mThhalv10004004m
Vitis viniferaGSVIVT01028556001GSVIVT01034544001GSVIVT01019162001GSVIVT01023003001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)