y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.008G100600.1
FamilyAA1
Protein PropertiesLength: 519 Molecular Weight: 57529.2 Isoelectric Point: 9.4443
ChromosomeChromosome/Scaffold: 08 Start: 10962520 End: 10964914
Descriptionlaccase 5
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1292960
  TRHYHFEIRHQNVTRLCHTKSMVTVNGQFPGPRIVAREGDRLLIKVTNHVPNNITIHWHGIRQLRSGWADGPAYVTQCPIQTGQTYVYNYTITGQRGTLF
  WHAHISWLRASLYGPLIILPKLNAQYPFAKPHKEVPMVFGEWWNVDPEAVVTQATQTGGGPNVSDAYTINGFPGPLYNCSRKDTFKLKVKPGKIYLLRFI
  NAALNDELFFSIANHTLTVVEADAVYVKPFTTNTLLIAPGQTTNVLLKTKSHYPNATFLMTARPLASA
AA12865040
  FLMTARPLASAQFPANVPQKVDKHFFFTVSLGTTPCQKNQTCQGPTNTTKFSASVNNVSYIQPTTALLQAHFFGQSNGVYTTDFPTKPLVPFNYTGTPPN
  NTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLHLHGFNFFVVGQGFGNYDPNKDPAKFNVVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHCHLE
  VHTTWGLKMAWLVLDGKLP
Full Sequence
Protein Sequence     Length: 519     Download
MGVSLVQIPV FLVLLINLCM FEVSLGGSTR HYHFEIRHQN VTRLCHTKSM VTVNGQFPGP    60
RIVAREGDRL LIKVTNHVPN NITIHWHGIR QLRSGWADGP AYVTQCPIQT GQTYVYNYTI    120
TGQRGTLFWH AHISWLRASL YGPLIILPKL NAQYPFAKPH KEVPMVFGEW WNVDPEAVVT    180
QATQTGGGPN VSDAYTINGF PGPLYNCSRK DTFKLKVKPG KIYLLRFINA ALNDELFFSI    240
ANHTLTVVEA DAVYVKPFTT NTLLIAPGQT TNVLLKTKSH YPNATFLMTA RPLASAQFPA    300
NVPQKVDKHF FFTVSLGTTP CQKNQTCQGP TNTTKFSASV NNVSYIQPTT ALLQAHFFGQ    360
SNGVYTTDFP TKPLVPFNYT GTPPNNTMVS NGTKVVVLPF NTSVELVMQD TSILGAESHP    420
LHLHGFNFFV VGQGFGNYDP NKDPAKFNVV DPVERNTVGV PSGGWVAIRF LADNPGVWFM    480
HCHLEVHTTW GLKMAWLVLD GKLPNQKLFP PPADLPKC*                           540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07732Cu-oxidase_31.0e-5235149117+
PLN02191PLN021917.0e-687508572+
PLN02604PLN026042.0e-7210492551+
TIGR03388ascorbase2.0e-8429487521+
TIGR03389laccase027518542+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN60348.10275189559hypothetical protein [Vitis vinifera]
EMBLCAN73336.1015181547hypothetical protein [Vitis vinifera]
EMBLCBI16224.1015181585unnamed protein product [Vitis vinifera]
RefSeqXP_002299296.1015181581predicted protein [Populus trichocarpa]
RefSeqXP_002329138.1015181581predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0305084536A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB1asq_A0305084536A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB1asp_B0305084536A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB1asp_A0305084536A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB1aso_B0305084536A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY81282128982950
DY81340729542970
DY26929829912970
DY81792429182970
DY80989328552880
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00935.1
Brassica rapaBra005140.269.564Bra005140.269.564
Carica papayaevm.model.supercontig_19.218evm.model.supercontig_139.15.299.495evm.model.supercontig_169.17.281.510evm.model.supercontig_169.17.281.510evm.model.supercontig_139.15.299.495
Citrus sinensisorange1.1g047904morange1.1g008592m.269.548orange1.1g008592m.269.548
Glycine maxGlyma13g41310.1
Gossypium raimondiiGorai.009G103600.1.261.496Gorai.009G103600.1.261.496
Linum usitatissimumLus10013800Lus10004975
Malus domesticaMDP0000127409
Panicum virgatumPavirv00032912mPavirv00002681mPavirv00055389m
Phaseolus vulgarisPhvul.008G100600.1.286.504Phvul.008G100600.1.286.504
Picea abiesMA_502044g0010MA_9147880g0010MA_115430g0010MA_10430876g0010MA_10053838g0010
MA_9198822g0010MA_14240g0010
Prunus persicappa018465mppa017222mppa022262m
Sorghum bicolorSb03g028920.1
Vitis viniferaGSVIVT01034140001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny