y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.008G112100.1
FamilyAA1
Protein PropertiesLength: 528 Molecular Weight: 59628.3 Isoelectric Point: 7.6681
ChromosomeChromosome/Scaffold: 08 Start: 13210543 End: 13213824
DescriptionLaccase/Diphenol oxidase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA135130
  IPRLCNDQVITAVNGQFPGPTIQVREGDTLVVHVLNKSPYDVTLHWHGIFQLLSGWADGPEYVTQCPIRPNHNFTYRFKIDGQEGTLWWHAHASFLRATV
  HGALFIHPRRNHPYAFPKPYKHVPILFAEWWKSNVMEFSDQTLTPSVAFMINGLPGDLYNCSQDQMFKLKVKPGKTYLLRIINTNFISQMFFKVANHRFT
  VVAIDAVYTTPYATDVVVIAPGQTTDVLLEANQPIGSYYMAASIYNTIQAAFDNTTTRGLVVYKGSKSTTPLMPIMPLFNDTKTAHKFYTELTGLVDRPH
  WLQCPNEVDENMFITFGLNLAPCPQNETCFGPKNTLVSSSMNNESFVLPSQKKMSMLEAFYYNESGIYTKDFPNRPPLEFDYTNPNNSLDFSLLFAPKST
  KVKKLKFNSTVEIVLQNTALLDTENHPMHIHGFNFFVLAQGFGNFNATRDRVKFNLVNPQMRNTIAVPDAGWAVIRFKANNPGIWMIHCHVDNHMSWGMA
  TAFEIENGPTP
Full Sequence
Protein Sequence     Length: 528     Download
MTIPRLCNDQ VITAVNGQFP GPTIQVREGD TLVVHVLNKS PYDVTLHWHG IFQLLSGWAD    60
GPEYVTQCPI RPNHNFTYRF KIDGQEGTLW WHAHASFLRA TVHGALFIHP RRNHPYAFPK    120
PYKHVPILFA EWWKSNVMEF SDQTLTPSVA FMINGLPGDL YNCSQDQMFK LKVKPGKTYL    180
LRIINTNFIS QMFFKVANHR FTVVAIDAVY TTPYATDVVV IAPGQTTDVL LEANQPIGSY    240
YMAASIYNTI QAAFDNTTTR GLVVYKGSKS TTPLMPIMPL FNDTKTAHKF YTELTGLVDR    300
PHWLQCPNEV DENMFITFGL NLAPCPQNET CFGPKNTLVS SSMNNESFVL PSQKKMSMLE    360
AFYYNESGIY TKDFPNRPPL EFDYTNPNNS LDFSLLFAPK STKVKKLKFN STVEIVLQNT    420
ALLDTENHPM HIHGFNFFVL AQGFGNFNAT RDRVKFNLVN PQMRNTIAVP DAGWAVIRFK    480
ANNPGIWMIH CHVDNHMSWG MATAFEIENG PTPSSTLPPP PPDLPTC*                 540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03390ascorbOXfungal2.0e-493505547+
PLN02191PLN021913.0e-717505539+
PLN02604PLN026046.0e-837506543+
TIGR03388ascorbase2.0e-887506544+
TIGR03389laccase02510516+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002276415.10152734565PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002308196.10152734562laccase 110a [Populus trichocarpa]
RefSeqXP_002322939.10152734569predicted protein [Populus trichocarpa]
RefSeqXP_002333273.10152734568predicted protein [Populus trichocarpa]
RefSeqXP_002527888.1015277540laccase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0750519521A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
PDB1asq_A0750519521A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
PDB1asp_B0750519521A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
PDB1asp_A0750519521A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
PDB1aso_B0750519521A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO797675487365100
EE59197955255100
DY2718403171484610
CK27258926822620
DY9412063051804830
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00804.1Aquca_009_00807.1Aquca_009_00807.2
Arabidopsis lyrata478237472269486975
Arabidopsis thalianaAT3G09220.1AT5G01040.1AT5G01050.1
Brachypodium distachyonBradi4g39330.1Bradi2g55050.1Bradi2g55060.1Bradi4g11827.1Bradi4g11850.1
Bradi3g45190.1Bradi1g10567.1Bradi3g22317.1Bradi4g11780.1Bradi4g11770.1
Bradi4g11840.1Bradi3g02290.1Bradi3g02300.1
Brassica rapaBra029753Bra028885Bra005699
Capsella rubellaCarubv10016347mCarubv10000548m
Glycine maxGlyma01g26750.1Glyma03g15800.5Glyma03g15805.1Glyma01g26750.2Glyma07g17170.1
Glyma18g41886.1Glyma18g41860.1Glyma07g17150.1Glyma18g41870.1
Malus domesticaMDP0000291183
Manihot esculentacassava4.1_006971m
Oryza sativaLOC_Os01g63200.1LOC_Os01g63190.1LOC_Os11g42200.1LOC_Os11g42220.1LOC_Os11g16260.1
LOC_Os10g20610.1
Panicum virgatumPavirv00040765mPavirv00049024mPavirv00038281mPavirv00007769mPavirv00063349m
Pavirv00062920mPavirv00053056mPavirv00047982mPavirv00069158mPavirv00051794m
Pavirv00019186mPavirv00057102mPavirv00039741mPavirv00033330mPavirv00023383m
Pavirv00050058mPavirv00043455mPavirv00033589mPavirv00032842mPavirv00018047m
Pavirv00032841mPavirv00054602mPavirv00028624mPavirv00051105mPavirv00056353m
Pavirv00054858mPavirv00054859m
Phaseolus vulgarisPhvul.010G005900.1
Setaria italicaSi021601mSi020688mSi027309mSi021573mSi021628m
Si004353mSi000613mSi026121mSi028303mSi027928m
Si009653mSi026113mSi028115mSi027394mSi026118m
Si026123mSi026150mSi026109mSi028248mSi027660m
Si026140mSi027267mSi026136mSi027586mSi026159m
Si026153mSi026117mSi028198mSi026161mSi026162m
Si008101mSi026299mSi026376mSi026137mSi024846m
Si001570mSi001277mSi001174mSi027990m.20.264Si027990m.20.264
Si027990m.273.533Si027990m.273.533
Sorghum bicolorSb08g011530.1Sb03g039960.1Sb03g039980.1Sb03g039970.1Sb05g026630.1
Sb03g009410.1Sb05g025570.1Sb02g000300.1
Thellungiella halophilaThhalv10020392mThhalv10020388mThhalv10013097mThhalv10013058mThhalv10015329m
Zea maysAC234190.1_FGT002
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)