y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.008G129900.1
FamilyGH16
Protein PropertiesLength: 284 Molecular Weight: 32738.9 Isoelectric Point: 8.6483
ChromosomeChromosome/Scaffold: 08 Start: 19979750 End: 19982181
Descriptionxyloglucan endotransglucosylase/hydrolase 2
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH16422062.2e-23
  VSLNQGKEVQLTMDNCSGSGFGSKMAYGSGLFQMRIKVPNRNSAGIVTAFYLSSKGGRHDELDFEFLGNRKGKPYRLQTNVFVDGQGNREQRIRLWFDPT
  AHFHTYRILWNQHQIVFFVDNVPIRVYKNKTNIGVGYPSKGMQIEATLWDAESWATNGGKTKTDW
Full Sequence
Protein Sequence     Length: 284     Download
MGSQSFIFLL LLVVHVAVQG SMDTETSFDQ NYEVVWGDDH VVSLNQGKEV QLTMDNCSGS    60
GFGSKMAYGS GLFQMRIKVP NRNSAGIVTA FYLSSKGGRH DELDFEFLGN RKGKPYRLQT    120
NVFVDGQGNR EQRIRLWFDP TAHFHTYRIL WNQHQIVFFV DNVPIRVYKN KTNIGVGYPS    180
KGMQIEATLW DAESWATNGG KTKTDWSYAP FRASFQGFDV SGCQVLTSNA KNCSSDKYWW    240
NRQKFWQLDP VRQSEYERIK HKYMTYDYCT DRKRYPEIPL ECL*                     300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02175GH16_lichenase1.0e-2034196177+
cd02183GH16_fungal_CRH1_transglycosylase3.0e-2383211144+
pfam00722Glyco_hydro_164.0e-6928208183+
PLN03161PLN031613.0e-881282287+
cd02176GH16_XET2.0e-15126282260+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005618cell wall
GO:0005975carbohydrate metabolic process
GO:0006073cellular glucan metabolic process
GO:0016762xyloglucan:xyloglucosyl transferase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_193045.10628210288xyloglucan:xyloglucosyl transferase, putative / xyloglucan endotransglycosylase, putative / endo-xyloglucan transferase, putative [Arabidopsis thaliana]
RefSeqXP_002264713.102428223278PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002266811.102428223278PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002301792.102528212270predicted protein [Populus trichocarpa]
RefSeqXP_002521076.1082828283Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1un1_B02428213272A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB1un1_A02428213272A Chain A, Polygalacturonase From Erwinia Carotovora Ssp. Carotovora
PDB1umz_B02428213272A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB1umz_A02428213272A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB2uwb_B02128213267A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO11654928562830
ES82789228932830
EE26019125382590
DY81880127872820
DY82017027872820
Orthologous Group
SpeciesID
Arabidopsis lyrata884593899104485216359038359039
883627883616
Arabidopsis thalianaAT4G13090.1AT3G25050.1AT3G48580.1AT4G13080.1
Brachypodium distachyonBradi1g44777.1Bradi1g71937.1
Brassica rapaBra001434Bra015093Bra001433
Carica papayaevm.model.supercontig_8.136
Capsella rubellaCarubv10016385mCarubv10005358mCarubv10006916mCarubv10006944mCarubv10018461m
Citrus clementinaCiclev10033360mCiclev10023425m
Citrus sinensisorange1.1g042925morange1.1g041460m
Cucumis sativusCucsa.067150.1
Eucalyptus grandisEucgr.H00787.1Eucgr.H00788.1Eucgr.K02717.1Eucgr.K02715.1
Fragaria vescamrna17598.1-v1.0-hybrid
Glycine maxGlyma18g35720.2Glyma18g35720.1Glyma08g46450.1
Gossypium raimondiiGorai.007G155700.1Gorai.004G226400.1
Linum usitatissimumLus10032879Lus10025919Lus10038182Lus10022784Lus10011845
Lus10022782
Malus domesticaMDP0000311020
Manihot esculentacassava4.1_032567m
Medicago truncatulaMedtr2g049030.1Medtr2g049130.1
Mimulus guttatusmgv1a010995mmgv1a011712mmgv1a020473mmgv1a011649mmgv1a025665m
mgv1a019895mmgv1a020281mmgv1a021895mmgv1a011700mmgv1a010970m
Oryza sativaLOC_Os06g13040.1
Panicum virgatumPavirv00069636mPavirv00044296mPavirv00046059m
Phaseolus vulgarisPhvul.008G129100.1
Picea abiesMA_300041g0010MA_10083496g0010MA_254951g0010
Populus trichocarpaPotri.002G244200.1
Prunus persicappa019741mppa027154m
Ricinus communis30204.m00174129904.m002924
Setaria italicaSi007117mSi006999m
Selaginella moellendorffii403283
Sorghum bicolorSb10g008540.1Sb10g008550.1
Thellungiella halophilaThhalv10002629mThhalv10010620mThhalv10026812m
Vitis viniferaGSVIVT01003280001GSVIVT01004746001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny