y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.008G147000.1
FamilyGT92
Protein PropertiesLength: 557 Molecular Weight: 64973.2 Isoelectric Point: 10.2636
ChromosomeChromosome/Scaffold: 08 Start: 28742077 End: 28743747
DescriptionDomain of unknown function (DUF23)
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT922624731.4e-21
  EICICTMLRNQARFLKEWVMYHAKIGVQRWYVYDNNSDDDIENVIYFLQRVGYNISQHLWPWVKTQEAGFAHCALRARSSCKWVAFIDVDEFFHIRMKGG
  LSDVIWQHAKPGENVGEIRTLCYSFGPSGRREVPKEGVAMGYTCRLSGSERHKSIVRPEALNQSLINVVHHFHLSAPFVAVDADKSKIVINHYKYQVWKV
  FKQKFYRRVATY
Full Sequence
Protein Sequence     Length: 557     Download
MKERRKRNGI VSWRALFWST LLLLVSSIFF TTLFFYPLND SQSPLLFRWE TPPTTSHATI    60
TIRETVMLPD QVLIFLNYPP SFRFHSKHDL LCLYFSADST SRLTQPPIQL HIARLHEQIV    120
RCALPPRGNT VSIFIKSDGV LPTKDSSTHH WTPLVYEALF DRDNTTLVFV KGLNLRPERL    180
IEPSRFQCIY GWDFTKPKFF LKTEVISGAQ EIIRCRTPKS ILIGQAHSIK VTIQTRDTVI    240
FPSIARPGLC ARHNTPKKKA YEICICTMLR NQARFLKEWV MYHAKIGVQR WYVYDNNSDD    300
DIENVIYFLQ RVGYNISQHL WPWVKTQEAG FAHCALRARS SCKWVAFIDV DEFFHIRMKG    360
GLSDVIWQHA KPGENVGEIR TLCYSFGPSG RREVPKEGVA MGYTCRLSGS ERHKSIVRPE    420
ALNQSLINVV HHFHLSAPFV AVDADKSKIV INHYKYQVWK VFKQKFYRRV ATYVADWKEK    480
QNAGSRDRAP GLGTKAVEPA DWANRFCEVK DFGLRNWVFR HFLDHRTHLL PWQPEFHHHI    540
RKRRRPKDKI IIQPFL*                                                   600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13704Glyco_tranf_2_48.0e-1127036699+
pfam01697Glyco_transf_922.0e-33259465235+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI17696.10153334579unnamed protein product [Vitis vinifera]
RefSeqNP_198888.1015531563unknown protein [Arabidopsis thaliana]
RefSeqXP_002270991.1015331546PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002300081.1015331552predicted protein [Populus trichocarpa]
RefSeqXP_002526930.1015331551ubiquitin-protein ligase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
1638
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8657763162245320
DR8084582772575320
DY3787372672685330
EY6620792642675300
DT9488602592575140
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00172.1Aquca_002_00375.1
Arabidopsis lyrata493908484521
Arabidopsis thalianaAT5G40720.1
Brachypodium distachyonBradi3g14080.1
Brassica rapaBra028472Bra025268
Carica papayaevm.model.supercontig_5.316
Citrus clementinaCiclev10030976m
Citrus sinensisorange1.1g043544morange1.1g037991m
Cucumis sativusCucsa.136130.1
Eucalyptus grandisEucgr.B03384.1
Glycine maxGlyma02g03040.1Glyma01g04515.1Glyma08g40440.1
Gossypium raimondiiGorai.009G345800.1Gorai.006G037600.1
Manihot esculentacassava4.1_034265mcassava4.1_007462m
Mimulus guttatusmgv1a001120mmgv1a003136m
Panicum virgatumPavirv00056779m
Phaseolus vulgarisPhvul.002G078300.1
Ricinus communis29736.m002092
Selaginella moellendorffii102746
Sorghum bicolorSb07g002140.1
Vitis viniferaGSVIVT01003965001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny