y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.008G149400.1
FamilyCE10
Protein PropertiesLength: 463 Molecular Weight: 50446.4 Isoelectric Point: 8.0318
ChromosomeChromosome/Scaffold: 08 Start: 30486972 End: 30490730
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE10254520
  IQTSSQHSDPFGITTRPEESVAAANPSFADGVATKDIHIDPLTSLSIRIFLPESALTAPELHSKPNNRPNHEPQPQPRSARLDSIARRKSYGPPLLEERR
  SNSCGGGSSVEGLNLMTDGAYRGYSPPAGAKGERRRLPVVLQFHGGGWVSGGSDSAANDVFCRRITELCDVIVIAVGYRLAPENRYPAAFEDGVKVLNWL
  AKQANLAECSRSMGGGRSGGHGGGNGGGEFKKSDAHKHIVDSFGASVVEPWLAAHADPSRCVLLGSSCGANIADYVARKAVEGGKLLDPVKVVAQVLMYP
  FFVGSVPTRSEIKLANSYFYDKAMCTLSWKLFLPEEEFSLDHPAANPLVPDRGPPLKLMPPTLTVVAEHDWMRDRAIAYSEELRKVNVDAPVLEYKDAVH
  EFATLDVLLKSPQAQVCAEDIAIWVKKY
Full Sequence
Protein Sequence     Length: 463     Download
MPSVAVKLYS VFFKFLLKHR LQNRIQTSSQ HSDPFGITTR PEESVAAANP SFADGVATKD    60
IHIDPLTSLS IRIFLPESAL TAPELHSKPN NRPNHEPQPQ PRSARLDSIA RRKSYGPPLL    120
EERRSNSCGG GSSVEGLNLM TDGAYRGYSP PAGAKGERRR LPVVLQFHGG GWVSGGSDSA    180
ANDVFCRRIT ELCDVIVIAV GYRLAPENRY PAAFEDGVKV LNWLAKQANL AECSRSMGGG    240
RSGGHGGGNG GGEFKKSDAH KHIVDSFGAS VVEPWLAAHA DPSRCVLLGS SCGANIADYV    300
ARKAVEGGKL LDPVKVVAQV LMYPFFVGSV PTRSEIKLAN SYFYDKAMCT LSWKLFLPEE    360
EFSLDHPAAN PLVPDRGPPL KLMPPTLTVV AEHDWMRDRA IAYSEELRKV NVDAPVLEYK    420
DAVHEFATLD VLLKSPQAQV CAEDIAIWVK KYISLRGHEF SY*                      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00135COesterase2.0e-515120659+
cd00312Esterase_lipase9.0e-615122685+
PRK10162PRK101621.0e-795229140+
COG0657Aes1.0e-33145446303+
pfam07859Abhydrolase_32.0e-60164427264+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAS99713.1014621428At3g27320 [Arabidopsis thaliana]
RefSeqNP_001030781.1014621428hydrolase [Arabidopsis thaliana]
RefSeqXP_002267088.1014621464PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002267130.1014621425PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002526925.1014621472conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2zsi_A3e-32161429113331A Chain A, The Crystal Structure Of Mouse Exo70 Reveals Unique Features Of The Mammalian Exocyst
PDB2zsh_A3e-32161429113331B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_F2e-28161429112330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_E2e-28161429112330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3ed1_D2e-28161429112330B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES789976383904630
HO792077282433240
EB4388452851794630
JK5155042741904630
DR9372002791854630
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00310.1Aquca_123_00012.1
Arabidopsis lyrata484517488268
Arabidopsis thalianaAT5G14310.1AT3G27320.2AT3G27320.1
Brachypodium distachyonBradi2g57920.1Bradi4g39410.1
Brassica rapaBra006247Bra032997Bra008767
Carica papayaevm.model.supercontig_130.43evm.model.supercontig_130.44
Capsella rubellaCarubv10017202mCarubv10000956m
Citrus clementinaCiclev10031742mCiclev10015160m
Citrus sinensisorange1.1g015994morange1.1g012432m
Cucumis sativusCucsa.156360.1
Eucalyptus grandisEucgr.B03228.1Eucgr.I01696.1
Fragaria vescamrna28030.1-v1.0-hybrid
Glycine maxGlyma19g24390.1Glyma16g06780.1Glyma05g06430.1Glyma19g22760.1
Gossypium raimondiiGorai.006G038400.1Gorai.007G074300.2Gorai.012G091000.1Gorai.002G190500.1Gorai.001G268100.1
Gorai.011G093200.1Gorai.007G074300.1
Linum usitatissimumLus10037056Lus10036931Lus10022326
Malus domesticaMDP0000464809MDP0000303241MDP0000479020MDP0000251187
Manihot esculentacassava4.1_006786mcassava4.1_009359m
Mimulus guttatusmgv1a026769mmgv1a021886mmgv1a005804m
Oryza sativaLOC_Os12g15400.1LOC_Os01g67600.1
Panicum virgatumPavirv00029958mPavirv00024043mPavirv00043387m
Physcomitrella patensPp1s540_9V6.1
Phaseolus vulgarisPhvul.004G057500.1
Picea abiesMA_19054g0010MA_10435834g0010
Populus trichocarpaPotri.008G180500.1Potri.008G180600.1Potri.T111700.1Potri.010G053700.1
Prunus persicappa025969mppa005102m
Ricinus communis29633.m00088529929.m004742
Selaginella moellendorffii123940
Sorghum bicolorSb03g042970.1
Thellungiella halophilaThhalv10013549m
Vitis viniferaGSVIVT01003964001GSVIVT01010303001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny