y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.008G171400.1
FamilyGH5
Protein PropertiesLength: 506 Molecular Weight: 56531.8 Isoelectric Point: 6.4338
ChromosomeChromosome/Scaffold: 08 Start: 44753405 End: 44757062
Description
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH52184936.09565e-43
  MKEHWSTFIVEDDFKFIASSGLNAVRIPIGWWIASDPTPPPPYVGGSLHALDNAFLWSQKYGLKIILDLHAAPGSQNGFEHSSSRDGSLEWGKTDETIQE
  TVRVIEFLTARYAKSPSLYAVELINEPFSPGVTLESLNKYYKAGYEAVRKHSSSAYVVLSNRLGPADPRELFPLANGFERSVIDVHYYNLFQDVFNAMTV
  QQNIDFIYNNRSSQLTHVTTSNGPLTFVGEWVAEWQVSGTTKEDYQRFAKAQLDVYGRATFGWAYWALKNVNNHWS
Full Sequence
Protein Sequence     Length: 506     Download
MTNCVNLKIW LLNLLTFFSV FSFSIGRSNA EFPVKAVNLG GWLVTEGWMK PSLFDGIPNK    60
DFLDGTALQF KSVTTGKYLC AESGGGTIIV ANRTAASGWE TFSLWRLDEN TFRFRVFNKQ    120
FVGLDGIQVV AVSNISTDSL TFHVVRESGN SSRVRIRASN GYFLQAKRED VVTADALKVN    180
NSWGDDDPSV FVMTIAGGMQ GEFQVTNGYG PTKAPQVMKE HWSTFIVEDD FKFIASSGLN    240
AVRIPIGWWI ASDPTPPPPY VGGSLHALDN AFLWSQKYGL KIILDLHAAP GSQNGFEHSS    300
SRDGSLEWGK TDETIQETVR VIEFLTARYA KSPSLYAVEL INEPFSPGVT LESLNKYYKA    360
GYEAVRKHSS SAYVVLSNRL GPADPRELFP LANGFERSVI DVHYYNLFQD VFNAMTVQQN    420
IDFIYNNRSS QLTHVTTSNG PLTFVGEWVA EWQVSGTTKE DYQRFAKAQL DVYGRATFGW    480
AYWALKNVNN HWSLEWMIKN GYINL*                                         540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00257Fascin3.0e-670176108+
pfam00150Cellulase1.0e-10221487276+
COG2730BglC3.0e-27210502331+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI18831.103250533505unnamed protein product [Vitis vinifera]
RefSeqNP_001064458.101950516508Os10g0370500 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002285806.1015051508PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002464704.103250541514hypothetical protein SORBIDRAFT_01g024390 [Sorghum bicolor]
RefSeqXP_002513884.1015051506conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3n9k_A3e-3420250150381A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB1eqp_A4e-3418850126376A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB2pc8_A4e-3420250151382A Chain A, E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans In Complex With Two Separately Bound Glucopyranoside Units At 1.8 A
Transmembrane Domains
StartEnd
726
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DC8989053801265050
GO266806282863670
JG5647013031894910
DC8992993191875050
GE6033082881824690
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi2g31690.1Bradi3g38500.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna16368.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.3Glyma18g01781.1Glyma06g47761.6
Glyma06g47761.1Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4
Glyma06g47761.7Glyma06g47761.3Glyma13g02030.2Glyma06g47750.1Glyma13g02000.1
Glyma08g14676.1Glyma05g31460.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.6Gorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3
Gorai.009G239600.2Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G041900.1
Gorai.003G044300.1Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044200.1Gorai.003G044000.3
Gorai.003G044000.2Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.2LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.001G254400.1Phvul.008G171300.1Phvul.002G261800.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001GSVIVT01008995001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)