y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.008G225700.1
FamilyGT64
Protein PropertiesLength: 332 Molecular Weight: 37985.7 Isoelectric Point: 9.3661
ChromosomeChromosome/Scaffold: 08 Start: 53886302 End: 53890691
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT64713230
  YSIVMNTWKRYDLLKQSIKHYSSCPRLESVHIVWSEPNPPSDILLKFLHHVVKSKPKDGRQVKLRFDINKEDSLNNRFKEIKDLETDAVFSIDDDVIFPC
  SSVEFAFDVWQSAPDTMVGFVPRVHWLDSLKDNDDKFSYGGWWSVWWTGTYSMVLSKAAFFHKKYFNIYTNEMPSSIREYITKNRNCEDIAMSFLVANAT
  GAPPIWVKGKIFEIGSTGISSLGGHSERRTECVNRFAAVYGRMPLVSTSVKAV
Full Sequence
Protein Sequence     Length: 332     Download
MRGSCCGWNR RTEQRFRLLA ISTVKSVKIK LLLCCCVALT LLAFSTSASS FVLWNNQTPL    60
PPLLSDSRRG YSIVMNTWKR YDLLKQSIKH YSSCPRLESV HIVWSEPNPP SDILLKFLHH    120
VVKSKPKDGR QVKLRFDINK EDSLNNRFKE IKDLETDAVF SIDDDVIFPC SSVEFAFDVW    180
QSAPDTMVGF VPRVHWLDSL KDNDDKFSYG GWWSVWWTGT YSMVLSKAAF FHKKYFNIYT    240
NEMPSSIREY ITKNRNCEDI AMSFLVANAT GAPPIWVKGK IFEIGSTGIS SLGGHSERRT    300
ECVNRFAAVY GRMPLVSTSV KAVDSRNIWF W*                                  360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam09258Glyco_transf_642.0e-10371323259+
Gene Ontology
GO TermDescription
GO:0016758transferase activity, transferring hexosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI25511.10933129351unnamed protein product [Vitis vinifera]
RefSeqNP_191142.10333111334EPC1 (ECTOPICALLY PARTING CELLS); UDP-glucosyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002267908.10933116338PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002311207.1013311330predicted protein [Populus trichocarpa]
RefSeqXP_002526868.1013311329Exostosin-2, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1on8_B4e-357132030277A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB1on8_A4e-357132030277A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB1on6_B4e-357132030277A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB1on6_A4e-357132030277A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB1omz_B4e-357132030277A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Transmembrane Domains
StartEnd
3153
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG9362102281053320
DV440052267653310
EX688371260733320
CA801238260192750
EL423691264693320
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_018_00173.1Aquca_013_00497.1Aquca_004_00315.3Aquca_004_00315.1Aquca_004_00315.4
Aquca_004_00315.2Aquca_004_00315.5Aquca_009_01030.2Aquca_009_01030.1Aquca_019_00086.1
Aquca_009_01029.1
Arabidopsis lyrata340192908336
Arabidopsis thalianaAT1G80290.2AT1G80290.1AT3G55830.1AT5G04500.1
Brachypodium distachyonBradi3g40395.1Bradi1g34550.1Bradi1g12290.1Bradi1g34550.2Bradi2g18300.1
Brassica rapaBra008483Bra007194Bra009448Bra028787
Carica papayaevm.model.supercontig_488.3evm.model.supercontig_19.204evm.model.supercontig_4.178evm.model.supercontig_128.65
Capsella rubellaCarubv10016140mCarubv10017597mCarubv10003280m
Chlamydomonas reinhardtiiCre12.g508700.t1.2
Citrus clementinaCiclev10010680mCiclev10032067mCiclev10030719m
Citrus sinensisorange1.1g020041morange1.1g045656m
Cucumis sativusCucsa.311230.1Cucsa.368680.1Cucsa.308870.2Cucsa.308870.1
Eucalyptus grandisEucgr.C04240.1Eucgr.G03038.1Eucgr.K00135.1Eucgr.G02723.2Eucgr.G02723.1
Eucgr.K00135.2
Fragaria vescamrna08756.1-v1.0-hybridmrna20928.1-v1.0-hybridmrna09156.1-v1.0-hybridmrna21215.1-v1.0-hybrid
Glycine maxGlyma15g03130.1Glyma14g19550.1Glyma14g06670.1Glyma02g42230.1Glyma14g06670.2
Glyma09g27660.1Glyma16g32650.1Glyma09g27660.2Glyma10g34440.2Glyma20g33120.3
Glyma20g33120.2Glyma14g06670.3
Gossypium raimondiiGorai.008G132700.3Gorai.008G132700.2Gorai.008G132700.1Gorai.012G075900.1Gorai.009G307300.1
Gorai.012G075900.2
Linum usitatissimumLus10020174Lus10040216Lus10028274Lus10031680Lus10037920
Lus10038646Lus10027392
Malus domesticaMDP0000318911MDP0000177948MDP0000292999MDP0000138795MDP0000212600
MDP0000169420
Manihot esculentacassava4.1_010734mcassava4.1_011626mcassava4.1_011602mcassava4.1_011301mcassava4.1_013504m
cassava4.1_010773mcassava4.1_002721mcassava4.1_002024mcassava4.1_012021m
Medicago truncatulaMedtr1g009180.1Medtr5g082110.1
Mimulus guttatusmgv1a026874mmgv1a009961mmgv1a009124mmgv1a023379mmgv1a024929m
Oryza sativaLOC_Os06g49150.1LOC_Os03g48010.1LOC_Os05g46260.1
Panicum virgatumPavirv00045941mPavirv00020436mPavirv00023272mPavirv00018756mPavirv00050841m
Pavirv00045066mPavirv00036974mPavirv00061476m
Physcomitrella patensPp1s242_74V6.1Pp1s87_187V6.1Pp1s242_81V6.1Pp1s72_263V6.1Pp1s117_57V6.1
Phaseolus vulgarisPhvul.002G252600.1Phvul.004G124500.1Phvul.007G144400.1
Picea abiesMA_277070g0010MA_140607g0010MA_30471g0010MA_948289g0010MA_8306453g0010
MA_10432291g0040
Populus trichocarpaPotri.006G278400.1Potri.010G191700.7Potri.010G191700.1Potri.008G065800.1Potri.010G191700.2
Potri.010G191700.5Potri.008G028900.2Potri.008G028900.1Potri.010G232700.3Potri.010G232700.2
Potri.010G232700.1Potri.010G191700.4Potri.010G191700.3Potri.010G191700.8Potri.010G191700.6
Prunus persicappa008992mppa008488mppa007532mppa002869m
Ricinus communis29589.m00129129669.m00081027916.m00015930147.m014149
Setaria italicaSi014019mSi006792mSi034429mSi021307m
Selaginella moellendorffii13310340321881258420395139351
Sorghum bicolorSb07g027170.1Sb10g029290.1Sb01g011790.1Sb09g026940.1
Thellungiella halophilaThhalv10000547mThhalv10010522mThhalv10012710m
Vitis viniferaGSVIVT01032860001GSVIVT01034672001
Volvox carteriVocar20000857m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)