y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.009G033200.1
FamilyGH13
Protein PropertiesLength: 784 Molecular Weight: 88493.3 Isoelectric Point: 5.9778
ChromosomeChromosome/Scaffold: 09 Start: 7239360 End: 7256403
Descriptionisoamylase 3
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132766400
  NIRGSYLGVIEKIPHLLELGINAVELLPVFEFDELEFQRRPNPRDHMINTWGYSTINFFSPMSRYASAGGGSVNASREFKEMVKALHSSGIEVILDVVYN
  HTNEADDANPYTTSFRGIDNKVYYMLDNNGQLLNFSGCGNTLNCNHAVVTELILDSLRHWVTEYHVDGFRFDLASVLCRGIDGSPLNAPPIIRAIAKDAV
  LSRCKIIAEPWDCGGLYLVGSFPNWDRWAEWNGKYRDDVRKFIKGDYGVKGSFATRVSGSSDLYKMNKRRPYHSINFVIAHDGFTLRDLVSYNLKHNEAN
  GEGGNDGTNDNFSWNCGFEGETDDASIRALRSRQMKNFHLALMISQGTPMMLMGDEYGHTRNGNN
Full Sequence
Protein Sequence     Length: 784     Download
MLLQPLLCGS KVASQSTLFA SVFSAENNAG RCSFTGNSSV RDVRPVRLMK QASGSITNNE    60
RGVFSEIMDR HKLKTPDAYG RRAQEGVLQE ESSKVMESRP SGKIFPGQAF PLGVSEVDSG    120
INFSIFSQHA TAVTLCLVLP ERGSIDTMNG DMIEVVLDPD LNKTGDIWHI CIEDLPRSNV    180
LYGYRIDGPQ DWGKGHRFDN SIVLVDPYAK LVEGRRYFGD ISTKLSRFLG TYDFDSLPFD    240
WGENYKLPNI SEKDLVIYEM NVRAFTFDES SGLDSNIRGS YLGVIEKIPH LLELGINAVE    300
LLPVFEFDEL EFQRRPNPRD HMINTWGYST INFFSPMSRY ASAGGGSVNA SREFKEMVKA    360
LHSSGIEVIL DVVYNHTNEA DDANPYTTSF RGIDNKVYYM LDNNGQLLNF SGCGNTLNCN    420
HAVVTELILD SLRHWVTEYH VDGFRFDLAS VLCRGIDGSP LNAPPIIRAI AKDAVLSRCK    480
IIAEPWDCGG LYLVGSFPNW DRWAEWNGKY RDDVRKFIKG DYGVKGSFAT RVSGSSDLYK    540
MNKRRPYHSI NFVIAHDGFT LRDLVSYNLK HNEANGEGGN DGTNDNFSWN CGFEGETDDA    600
SIRALRSRQM KNFHLALMIS QGTPMMLMGD EYGHTRNGNN NSYGHDTTIN NFLWDQLDAQ    660
KSDHFRFFSK VIKYRHAHEV FSHESFLGKN DITWHEDNWD NHDSKFLAFT LHDRSGADIY    720
LAFNAHEYFV KVLLPTPPEM RKWFRVGDTN LKSPEDFVLD GVHSIGNTYN IAPYSSILLE    780
AKY*                                                                 840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK14510PRK145107.0e-137106735668+
PRK03705PRK037057.0e-153106658574+
cd11326AmyAc_Glg_debranch0239678444+
COG1523PulA0106757687+
TIGR02100glgX_debranch0106779724+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAZ81837.10517832736isoamylase isoform 3 [Pisum sativum]
DDBJBAF52943.1017831783isoamylase-type starch-debranching enzyme 3 [Phaseolus vulgaris]
EMBLCBI19205.1027821774unnamed protein product [Vitis vinifera]
RefSeqXP_002284042.10278213786PREDICTED: similar to isoamylase-type starch-debranching enzyme 3 [Vitis vinifera]
RefSeqXP_002513977.1057827781isoamylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B010676114699A Chain A, Crystal Structure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans
PDB2vuy_A010676114699A Chain A, Crystal Structure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans
PDB2vr5_B010676114699A Chain A, Crystal Structure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans
PDB2vr5_A010676114699A Chain A, Crystal Structure Of Amylomaltase From Thermus Aquaticus, A Glycosyltransferase Catalysing The Production Of Large Cyclic Glucans
PDB2vnc_B010676114699A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7987254522016520
HO7796252455407840
HO7796251813585380
HO4308582665197820
HO798725506527010.0000000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.012G008800.1Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3
Potri.006G070800.2Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2
Potri.018G132500.1Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)