y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.009G115600.1
FamilyGT13
Protein PropertiesLength: 430 Molecular Weight: 50048.2 Isoelectric Point: 6.6098
ChromosomeChromosome/Scaffold: 09 Start: 17312479 End: 17335772
Descriptionalpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, putative
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT13224220
  IQMRLFATQSGYADRLAAAIEAENHCTSQMRSLIDQISLQQGRIVAFEEERKRLEQECGQMKSLVQDLERKDLQRLTDKMQVPVAAVVVITCNRADYLER
  TINSVLKYQRPISSRFPLFVSQDGSDPDVKSKALSYDQLSYMQHLDFEPVQTERPGEIIAYYKIASHYKWALDVLFYKHNFSRVIILEDDMDIAPDFFDY
  FEAAATLLDKDKSIMAVSSWNDNGQKQFVHDSYELYRSDFFPGLGWMLVRSIWDELKENHKGRQFIRPEVCRTYNFGEHGSSFGLFFKKYLEPIKLNDVK
  VNWRSMDLSYLLEDRYSMHFANTVKKATPVYGADMVLKAYNIDGDVRIKYKDQSDFENIARQFGIFEEWKDGVPRTAYKGVVVFRHQTSRRIFLVGPESL
  K
Full Sequence
Protein Sequence     Length: 430     Download
MAKVFCDFRF LLLVAAGVFI YIQMRLFATQ SGYADRLAAA IEAENHCTSQ MRSLIDQISL    60
QQGRIVAFEE ERKRLEQECG QMKSLVQDLE RKDLQRLTDK MQVPVAAVVV ITCNRADYLE    120
RTINSVLKYQ RPISSRFPLF VSQDGSDPDV KSKALSYDQL SYMQHLDFEP VQTERPGEII    180
AYYKIASHYK WALDVLFYKH NFSRVIILED DMDIAPDFFD YFEAAATLLD KDKSIMAVSS    240
WNDNGQKQFV HDSYELYRSD FFPGLGWMLV RSIWDELKEN HKGRQFIRPE VCRTYNFGEH    300
GSSFGLFFKK YLEPIKLNDV KVNWRSMDLS YLLEDRYSMH FANTVKKATP VYGADMVLKA    360
YNIDGDVRIK YKDQSDFENI ARQFGIFEEW KDGVPRTAYK GVVVFRHQTS RRIFLVGPES    420
LKLLQIEES*                                                           480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00535Glycos_transf_20.00910815750+
pfam13641Glyco_tranf_2_30.001107277193+
cd00761Glyco_tranf_GTA_type0.000810815750+
cd02514GT13_GLCNAC-TI8.0e-151105420336+
pfam03071GNT-I015427434+
Gene Ontology
GO TermDescription
GO:0000139Golgi membrane
GO:0003827alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
GO:0006487protein N-linked glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU18645.1013591374unknown [Glycine max]
EMBLCAC80700.1014291444N-acetylglucosaminyltransferase I [Arabidopsis thaliana]
EMBLCAC80702.1034295446N-acetylglucosaminyltransferase I [Nicotiana tabacum]
EMBLCBI29533.1014271439unnamed protein product [Vitis vinifera]
RefSeqNP_195537.2014291444CGL1 (COMPLEX GLYCAN LESS 1); alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase/ protein N-acetylglucosaminyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1foa_A01024205339A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB1fo9_A01024205339A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB2apc_A01054202333A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB2am5_A01054202333A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
PDB2am4_A01054202333A Chain A, Crystal Structure Of N-acetylglucosaminyltransferase I
Transmembrane Domains
StartEnd
527
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BM77974527352770
BM78005627352770
EH7311532911524270
FS32592325412540
FS31985425012500
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00911.3Aquca_007_00911.4Aquca_007_00911.2Aquca_007_00911.1Aquca_007_00911.5
Arabidopsis lyrata912565490588
Arabidopsis thalianaAT4G38240.1AT4G38240.2AT4G38240.3
Brachypodium distachyonBradi3g60820.3Bradi3g60820.1Bradi3g60820.2
Brassica rapaBra033557
Carica papayaevm.TU.contig_28580.1.22.235evm.TU.contig_28580.1.235.387evm.TU.contig_28580.1.235.387evm.TU.contig_28580.1.22.235
Capsella rubellaCarubv10007540m
Citrus clementinaCiclev10028418m
Citrus sinensisorange1.1g019888morange1.1g012912morange1.1g012941m
Cucumis sativusCucsa.099720.1Cucsa.099720.2
Eucalyptus grandisEucgr.L00584.1Eucgr.L00583.1Eucgr.H04987.1Eucgr.H04987.2Eucgr.H04989.3
Eucgr.H04989.2Eucgr.H04989.4Eucgr.H04989.1
Fragaria vescamrna17328.1-v1.0-hybrid
Glycine maxGlyma04g00200.1Glyma06g00230.1
Gossypium raimondiiGorai.008G014000.2Gorai.008G014000.3Gorai.008G014000.1
Linum usitatissimumLus10022994Lus10001389
Malus domesticaMDP0000173465.283.435MDP0000170967.230.351MDP0000170967.22.209MDP0000170967.22.209MDP0000173465.283.435
MDP0000173465.22.268MDP0000173465.22.268MDP0000170967.230.351
Manihot esculentacassava4.1_024783m
Medicago truncatulaMedtr3g118520.1Medtr3g118520.2Medtr3g118520.3
Mimulus guttatusmgv1a006517mmgv1a006750m
Oryza sativaLOC_Os02g58590.1.304.426LOC_Os02g58590.1.304.426LOC_Os02g58590.1.22.283LOC_Os02g58590.1.22.283
Panicum virgatumPavirv00053907mPavirv00020030m
Physcomitrella patensPp1s100_54V6.1Pp1s246_61V6.1
Picea abiesMA_901813g0010
Populus trichocarpaPotri.009G168000.2Potri.009G168000.1Potri.009G168000.4Potri.004G206900.3Potri.004G206900.1
Potri.004G206900.2Potri.009G168000.3
Prunus persicappa006221m
Ricinus communis29675.m000398.22.23129675.m000398.232.34829675.m000398.232.34829675.m000398.22.231
Setaria italicaSi006441mSi006440m
Selaginella moellendorffii268301
Sorghum bicolorSb08g003660.1
Thellungiella halophilaThhalv10025211mThhalv10025208mThhalv10025250m
Vitis viniferaGSVIVT01002028001GSVIVT01002907001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny