y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.009G135900.1
FamilyGH9
Protein PropertiesLength: 587 Molecular Weight: 65415.7 Isoelectric Point: 5.9185
ChromosomeChromosome/Scaffold: 09 Start: 19950277 End: 19952651
Descriptionglycosyl hydrolase 9A1
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH91145650
  VAINQALTFYDAQKSGHYPSNSPVKFRGDSGLQDGDSANTDLTGGFYDSGNNIKFTFTTAYTMTLLSWTVMEYQSKYADIGELDHVRDIIRWGSDYLLKV
  GSTIRINNEHSDLSCWQRPEDMKYERSVSICDGSATDLAGEIVAALSAASMVFKDDRDYSKRLVEAAERLFGAIPAKQGTYTMVDGCGKQARMLYNSTSY
  QDELAWGATWLFLATEDTNYLATATETFFSAKGNESSVDKGVVYWNNKLNAVEVLLTGIRYFRDPGFPYEDALKLSSNLTEAHMCSYLFSKYFSRTPGGL
  IILKPDNEPLLQFAATASFLSKLYSDYLDHLKMSGASCETDSFSVKMLRDFATSQVNYILGQNPMKMSYLVGYGDRYPVQVHHRSASIPWNNQPYNCDDG
  KRWLNSKDPNPQVLLGAMVGGPDTNDNFMDQRTNQRFTEPNIASNAGLVAAL
Full Sequence
Protein Sequence     Length: 587     Download
MPPAVSSAFE SERAPVIYVH TVSEAGRLLP SASQWNSIAL DFKLAPHSST AYESIPSQYP    60
KSVDYDLVIT DRKHFHCFIF VLVTIILAIL AAVLLVYFLP QKHKHQGSSI NLKVAINQAL    120
TFYDAQKSGH YPSNSPVKFR GDSGLQDGDS ANTDLTGGFY DSGNNIKFTF TTAYTMTLLS    180
WTVMEYQSKY ADIGELDHVR DIIRWGSDYL LKVGSTIRIN NEHSDLSCWQ RPEDMKYERS    240
VSICDGSATD LAGEIVAALS AASMVFKDDR DYSKRLVEAA ERLFGAIPAK QGTYTMVDGC    300
GKQARMLYNS TSYQDELAWG ATWLFLATED TNYLATATET FFSAKGNESS VDKGVVYWNN    360
KLNAVEVLLT GIRYFRDPGF PYEDALKLSS NLTEAHMCSY LFSKYFSRTP GGLIILKPDN    420
EPLLQFAATA SFLSKLYSDY LDHLKMSGAS CETDSFSVKM LRDFATSQVN YILGQNPMKM    480
SYLVGYGDRY PVQVHHRSAS IPWNNQPYNC DDGKRWLNSK DPNPQVLLGA MVGGPDTNDN    540
FMDQRTNQRF TEPNIASNAG LVAALIALQD PPYNSRDVKS TLWGWT*                  600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02340PLN023403.0e-103115581485+
PLN00119PLN001197.0e-105109568474+
PLN02613PLN026133.0e-108115582487+
pfam00759Glyco_hydro_91.0e-120119565457+
PLN02345PLN023453.0e-130115568470+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAQ63883.1015851600cellulase [Medicago truncatula]
EMBLCAN71528.1015771589hypothetical protein [Vitis vinifera]
EMBLCBI19980.1014491475unnamed protein product [Vitis vinifera]
RefSeqXP_002278065.1015771600PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002526151.10125709582endo-1,4-beta-glucanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ksd_A01095682428A Chain A, Crystal Structure Of Class I Chitinase From Oryza Sativa L. Japonica
PDB1ksc_A01095682428A Chain A, Crystal Structure Of Class I Chitinase From Oryza Sativa L. Japonica
PDB1ks8_A01095682428A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_B01095683440A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
PDB4tf4_A01095683440A Chain A, The Structure Of Endoglucanase From Termite, Nasutitermes Takasagoensis, At Ph 2.5.
Transmembrane Domains
StartEnd
7799
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BF0104444821115680
HO7946744931115770
BQ1655672611994400
HO7962134591375680
BQ1655681913975870
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00010.1Aquca_058_00008.1Aquca_014_00010.2Aquca_014_00403.1
Arabidopsis lyrata495032858221894138
Arabidopsis thalianaAT5G49720.1AT4G24260.1AT1G65610.1
Brachypodium distachyonBradi1g09460.1Bradi1g63560.1Bradi5g14580.1
Brassica rapaBra000594Bra040496Bra019237Bra013781Bra022470
Bra016970Bra039767
Carica papayaevm.model.supercontig_17.23evm.model.supercontig_88.37evm.model.supercontig_151.55evm.model.supercontig_49.52
Capsella rubellaCarubv10027986mCarubv10004382mCarubv10019972m
Citrus clementinaCiclev10000600mCiclev10014583mCiclev10024241mCiclev10003884mCiclev10003122m
Citrus sinensisorange1.1g007014morange1.1g007041morange1.1g013516morange1.1g046335morange1.1g013288m
orange1.1g041590morange1.1g043321m
Cucumis sativusCucsa.260330.1Cucsa.178750.1Cucsa.212770.1
Eucalyptus grandisEucgr.G00035.1Eucgr.A00393.1Eucgr.G00035.2Eucgr.F02731.1
Fragaria vescamrna29283.1-v1.0-hybridmrna25126.1-v1.0-hybrid
Glycine maxGlyma09g02160.1Glyma15g13080.1Glyma17g00710.1Glyma07g40090.1Glyma20g06820.1
Glyma06g12910.2Glyma06g12910.3Glyma04g41891.1
Gossypium raimondiiGorai.011G089500.1Gorai.010G143300.1Gorai.010G143300.2Gorai.008G141900.1Gorai.010G143300.3
Gorai.011G089500.2Gorai.003G089600.1Gorai.003G089600.2Gorai.003G089600.3
Linum usitatissimumLus10026275Lus10012162Lus10026863Lus10018918Lus10028619
Lus10010029Lus10036331Lus10007584
Malus domesticaMDP0000225700MDP0000388002MDP0000452189MDP0000518321MDP0000313820.215.533
MDP0000313820.215.533MDP0000308015MDP0000896140MDP0000140066.486.637MDP0000140066.486.637
MDP0000221017MDP0000160026MDP0000313820.118.215MDP0000313820.118.215MDP0000144703
Manihot esculentacassava4.1_003705mcassava4.1_003712mcassava4.1_026565m
Medicago truncatulaMedtr2g028480.1Medtr3g082440.1Medtr3g090540.1Medtr4g128810.1
Mimulus guttatusmgv1a003033mmgv1a002977mmgv1a002970mmgv1a002960mmgv1a022358m
mgv1a018926mmgv1a018124mmgv1a024415mmgv1a026839m
Oryza sativaLOC_Os03g21210.1LOC_Os03g52630.1LOC_Os03g52630.2LOC_Os04g41970.1LOC_Os12g24040.1
Panicum virgatumPavirv00061241mPavirv00029143mPavirv00040687mPavirv00029144mPavirv00038435m
Pavirv00038432mPavirv00007671mPavirv00061242mPavirv00005986mPavirv00061243m
Pavirv00044338mPavirv00049329mPavirv00048097m
Physcomitrella patensPp1s190_6V6.1Pp1s157_35V6.1Pp1s35_333V6.1Pp1s15_429V6.1Pp1s64_152V6.1
Phaseolus vulgarisPhvul.003G089600.1Phvul.006G133700.1Phvul.006G004900.1
Picea abiesMA_69345g0010MA_102312g0010.133.408MA_102312g0010.133.408MA_9211546g0010MA_102312g0010.413.556
MA_102312g0010.413.556MA_6683906g0010.193.294MA_6683906g0010.193.294
Populus trichocarpaPotri.003G151700.1Potri.003G151700.2Potri.001G078900.1Potri.003G151700.3Potri.010G177300.1
Potri.008G079500.1Potri.010G177300.3Potri.010G177300.2Potri.003G151700.4Potri.005G188500.1
Potri.002G071200.1
Prunus persicappa002911mppa014845mppa026228mppa019140m
Ricinus communis30063.m00143629929.m00450230076.m00469627985.m000864
Setaria italicaSi034713mSi009616mSi012680mSi035386m
Selaginella moellendorffii26652275214
Sorghum bicolorSb01g036480.1Sb01g008860.1Sb06g021440.1
Thellungiella halophilaThhalv10012978mThhalv10024681mThhalv10018270mThhalv10003366mThhalv10012932m.108.387
Thhalv10012932m.108.387Thhalv10012932m.412.610Thhalv10012932m.412.610
Vitis viniferaGSVIVT01023102001GSVIVT01006265001GSVIVT01010049001GSVIVT01006152001
Zea maysAC199765.4_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)