y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.009G148900.1
FamilyCE8
Protein PropertiesLength: 550 Molecular Weight: 60976.1 Isoelectric Point: 8.7461
ChromosomeChromosome/Scaffold: 09 Start: 21764864 End: 21767620
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82415400
  VVCKGGDCYKTVQAAVNAAPDNAEGRFVIYIKEGVYEEKVRVPYRKKNVVFLGDGMGRTVITGSANVAQPGITTYSSATVGVAGDGFMAKDLTIENTAGA
  NAHQAVAFRSDSDLSVIENCEFIGNQDTLYAHSLRQFYKSCRILGNVDFIFGNSAAIFQDCEILVRPRQDRPEKGENNAVTAHGRTDPAQSTGFVFQNCL
  VNGTEEYMALYYSKPQVHKNYLGRPWKEYSRTVFIHTFFETLITPEGWMPWTGDFALNTLYYGEFENSGPGSNLTQRVPWSNQVPAEHVFSYSYQNFIQG
Full Sequence
Protein Sequence     Length: 550     Download
MRKPTKPIPT FLPISILRST LFLLILSMAS LFFLSLLFFL NLHPHSSAVE IHRACNATRF    60
PPQCHASLSP RVPPNPTPLQ IVQSALRASS SNLVTARSKV RSIVSASANN RTRLTNAKSC    120
RQVLHYSRHR TNLAKAALLR GATKDARAWM SASLGYQYGC WNGLKYINHT ALVAETMSFL    180
ESLVTLSSNA LSMMVSYDIF GNDTASWRPP MTERDGFWEP SGTPGLGALP KIAENLKADA    240
VVCKGGDCYK TVQAAVNAAP DNAEGRFVIY IKEGVYEEKV RVPYRKKNVV FLGDGMGRTV    300
ITGSANVAQP GITTYSSATV GVAGDGFMAK DLTIENTAGA NAHQAVAFRS DSDLSVIENC    360
EFIGNQDTLY AHSLRQFYKS CRILGNVDFI FGNSAAIFQD CEILVRPRQD RPEKGENNAV    420
TAHGRTDPAQ STGFVFQNCL VNGTEEYMAL YYSKPQVHKN YLGRPWKEYS RTVFIHTFFE    480
TLITPEGWMP WTGDFALNTL YYGEFENSGP GSNLTQRVPW SNQVPAEHVF SYSYQNFIQG    540
DDWYHHFSQ*                                                           600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02745PLN027454.0e-11551541520+
PLN02713PLN027136.0e-11844543551+
PLN02301PLN023012.0e-12144543515+
pfam01095Pectinesterase9.0e-163239541307+
PLN02708PLN02708044543509+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002275192.105054739543PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002281640.104354341550PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002306241.105154353553predicted protein [Populus trichocarpa]
RefSeqXP_002309906.104154343559predicted protein [Populus trichocarpa]
RefSeqXP_002517239.104654341547Pectinesterase-2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A024154311307A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A02385433303B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_B2e-202395165315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_A2e-202395165315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntp_B2e-202395165315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Transmembrane Domains
StartEnd
2143
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT7451542752695430
EX6715762732715430
HO8014251723725430
HO8014251911853710
EC9561722632815430
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_1260_00001.1Aquca_022_00312.1
Arabidopsis lyrata919784325521
Arabidopsis thalianaAT5G09760.1AT5G64640.1
Brachypodium distachyonBradi2g56820.1Bradi5g10700.1
Brassica rapaBra024317Bra028619Bra037786Bra006031Bra009401
Bra028617Bra009400Bra002149
Carica papayaevm.model.supercontig_42.121
Capsella rubellaCarubv10026126mCarubv10000564m
Citrus clementinaCiclev10025271m
Citrus sinensisorange1.1g009085m
Cucumis sativusCucsa.249950.1
Eucalyptus grandisEucgr.H04944.1
Fragaria vescamrna26037.1-v1.0-hybridmrna17879.1-v1.0-hybrid
Glycine maxGlyma05g32380.1Glyma08g15650.1Glyma06g15711.1
Gossypium raimondiiGorai.011G116400.1Gorai.003G067900.1Gorai.007G064900.1
Linum usitatissimumLus10013721Lus10033486Lus10020888Lus10005587
Malus domesticaMDP0000196867MDP0000200773MDP0000233370MDP0000297071MDP0000174996
MDP0000204084MDP0000173284MDP0000174791
Manihot esculentacassava4.1_006847mcassava4.1_004527mcassava4.1_004459mcassava4.1_021091mcassava4.1_005773m
Medicago truncatulaMedtr8g093460.1Medtr3g095920.1
Mimulus guttatusmgv1a004027mmgv1a008938mmgv1a007669mmgv1a003977mmgv1a019250m
Oryza sativaLOC_Os01g65790.1LOC_Os04g35770.1
Panicum virgatumPavirv00054696mPavirv00008464mPavirv00032807mPavirv00008364m
Physcomitrella patensPp1s382_22V6.1Pp1s216_42V6.1Pp1s151_23V6.2Pp1s76_125V6.1Pp1s151_23V6.1
Phaseolus vulgarisPhvul.002G270900.1
Picea abiesMA_10430460g0010.462.762MA_10427058g0010.383.512MA_10427058g0010.383.512MA_10427058g0010.79.248MA_10427058g0010.79.248
MA_906551g0010MA_2253g0010MA_54974g0010MA_68362g0010MA_10430460g0010.462.762
MA_67675g0010MA_495624g0010
Populus trichocarpaPotri.005G061500.1Potri.007G107300.2Potri.007G107300.3Potri.007G107300.1
Prunus persicappa021056mppa024386mppa003915m
Ricinus communis30136.m001028
Setaria italicaSi005458mSi010057m
Selaginella moellendorffii8374476314420760
Sorghum bicolorSb06g017280.1Sb03g041680.1
Thellungiella halophilaThhalv10013067mThhalv10003853m
Vitis viniferaGSVIVT01026518001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)