y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.009G153000.1
FamilyGH35
Protein PropertiesLength: 717 Molecular Weight: 80423 Isoelectric Point: 6.4103
ChromosomeChromosome/Scaffold: 09 Start: 22229807 End: 22236799
DescriptionGlycosyl hydrolase family 35 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35333370
  LIIDGQRKILFSGSIHYPRSTPQMWPDLIAKAKEGGVDVIQTYVFWNLHEPQLGKYDFSGRNDLVGFIKEIAAQGMYVCLRIGPFIEAEWTYGGFPFWLH
  DIPGIVYRTDNEPFKFYMQNFTTKIVNMMTAENLYASQGGPIILSQIENEYQNIQRAFGTAGSQYVQWAAKMAVGLDTGVPWIMCKETDAPDPVINTCNG
  MKCGETFTGPNSPNKPALWTENWTSFYQVYGALPYIRSAEDIAFHVTLFVARNGSYINYYMYHGGTNFGRTGAAYVITGYYDQAPLDEYGLLRQPKWGHL
  KQLHT
Full Sequence
Protein Sequence     Length: 717     Download
MEKWVVLVML LLSWKIREAF GAKAEITYDG RSLIIDGQRK ILFSGSIHYP RSTPQMWPDL    60
IAKAKEGGVD VIQTYVFWNL HEPQLGKYDF SGRNDLVGFI KEIAAQGMYV CLRIGPFIEA    120
EWTYGGFPFW LHDIPGIVYR TDNEPFKFYM QNFTTKIVNM MTAENLYASQ GGPIILSQIE    180
NEYQNIQRAF GTAGSQYVQW AAKMAVGLDT GVPWIMCKET DAPDPVINTC NGMKCGETFT    240
GPNSPNKPAL WTENWTSFYQ VYGALPYIRS AEDIAFHVTL FVARNGSYIN YYMYHGGTNF    300
GRTGAAYVIT GYYDQAPLDE YGLLRQPKWG HLKQLHTVIK SCSTTLLQGV QSNFSLGQVQ    360
EGYVFQEEKG GCVAFLINND RANKVTVQFR NRSYELLPKS ISILPDCQNV TFNTANVNTP    420
SNTRIISPKQ KFSSVDVWKQ FQDFIPSFDD TSLKSNSFLE QMNTTKDESD YLWYTHRFEN    480
NLSCSKPTLS VQSAAHVAHA FVNNTYIGGA HGNHDVKSFT LEFPVTLHEG TNNLSILSVM    540
VGLPDSGAFL ERRFAGLISM QLQCSKGESL NLTNSLWGYK VGLLGEQLQV YKGQNSSGIE    600
WRELGNIKEQ TLIWYKTTFE TPKGEDPVVL DLSSMGKGEA WVNGQSIGRY WILFHDSKGN    660
PSQSLYHVPR SFLQDSGNVL VLVDECGGNP LGISLDTVSV TDLHQNFSKL SFPSSS*       720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13364BetaGal_dom4_58.0e-6446544105+
pfam02449Glyco_hydro_426.0e-848190166+
COG1874LacA2.0e-2326315332+
pfam01301Glyco_hydro_356.0e-15232339322+
PLN03059PLN0305906695722+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF01618.102271128718beta-galactosidase like protein [Arabidopsis thaliana]
EMBLCAN82672.101970318676hypothetical protein [Vitis vinifera]
EMBLCBI21611.102470324710unnamed protein product [Vitis vinifera]
RefSeqXP_002274012.102470360739PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002307056.1047137714predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A1e-393233514325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3d3a_A0.0002465687374575A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D7e-30163591354A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C7e-30163591354A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_B7e-30163591354A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778160714247000
HO780602586766510
DY961675287243090
HO795552549976340
HO780602416516870.99
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00260.2Aquca_014_00260.1Aquca_006_00263.3Aquca_006_00263.2Aquca_006_00263.1
Arabidopsis lyrata496568476906491156480556912308
Arabidopsis thalianaAT5G63800.1AT1G77410.1AT4G38590.2AT4G38590.1AT2G16730.1
AT4G35010.1
Brachypodium distachyonBradi2g56597.1Bradi3g42330.1Bradi4g36517.1Bradi2g24670.1
Brassica rapaBra029200Bra011577Bra017687Bra013052Bra001991
Bra033571Bra024237
Carica papayaevm.model.supercontig_37.29evm.model.supercontig_64.121evm.model.supercontig_64.120evm.model.supercontig_37.144
Capsella rubellaCarubv10028665mCarubv10022317mCarubv10007813mCarubv10006573mCarubv10016129m
Citrus clementinaCiclev10000420mCiclev10004034mCiclev10003478mCiclev10023501mCiclev10026929m
Ciclev10030124m
Citrus sinensisorange1.1g003612morange1.1g041957morange1.1g045037morange1.1g035496morange1.1g006326m
orange1.1g006301m
Cucumis sativusCucsa.060550.1Cucsa.370570.1
Eucalyptus grandisEucgr.H05090.1Eucgr.G01775.1Eucgr.I02332.1Eucgr.I01412.1
Fragaria vescamrna24180.1-v1.0-hybridmrna11229.1-v1.0-hybridmrna06055.1-v1.0-hybridmrna07651.1-v1.0-hybrid
Glycine maxGlyma06g16430.1Glyma04g38580.3Glyma08g00470.1Glyma04g38580.1Glyma04g38580.2
Glyma08g00470.2Glyma04g42620.3Glyma06g12150.1Glyma04g42620.2Glyma06g12150.2
Glyma12g03650.1Glyma12g03650.2Glyma04g00520.1Glyma11g11500.1
Gossypium raimondiiGorai.012G037700.1Gorai.010G052200.1Gorai.010G052300.1Gorai.009G265200.1Gorai.002G197200.3
Gorai.002G197200.2Gorai.002G197200.1Gorai.002G197100.1Gorai.008G036000.1
Linum usitatissimumLus10020875.306.587Lus10020875.306.587Lus10028538Lus10033502Lus10033427
Lus10018138Lus10008259Lus10033500Lus10020875.38.306Lus10020875.38.306
Lus10014126Lus10019784Lus10005071Lus10027844Lus10027843
Malus domesticaMDP0000202466MDP0000316304MDP0000243780MDP0000206284MDP0000322037
MDP0000320504MDP0000225967MDP0000222132MDP0000863563
Manihot esculentacassava4.1_033913mcassava4.1_025630mcassava4.1_023088mcassava4.1_031197mcassava4.1_023181m
cassava4.1_023219m
Medicago truncatulaMedtr3g096910.1Medtr8g095690.1Medtr3g088520.1Medtr3g117840.1Medtr4g073290.1
Mimulus guttatusmgv1a018569mmgv1a001345m
Oryza sativaLOC_Os05g35360.1LOC_Os08g43570.1LOC_Os09g36810.1
Panicum virgatumPavirv00062685mPavirv00037142mPavirv00063105mPavirv00038064mPavirv00037143m
Pavirv00021342mPavirv00010263mPavirv00038026mPavirv00010484m
Phaseolus vulgarisPhvul.009G127500.1Phvul.009G119400.1Phvul.L007600.1Phvul.009G119600.1Phvul.011G035300.1
Picea abiesMA_65469g0020
Populus trichocarpaPotri.005G069200.2Potri.005G069200.1Potri.005G180600.1Potri.002G080700.1Potri.013G105100.1
Potri.009G134400.1Potri.004G174800.1
Prunus persicappa001308mppa019277mppa026900mppa020492m
Ricinus communis29648.m00200830074.m001370
Setaria italicaSi004751mSi021244mSi024535mSi013260mSi028962m
Sorghum bicolorSb09g021140.1Sb07g024870.1Sb02g031260.1
Thellungiella halophilaThhalv10018129mThhalv10005464mThhalv10024392mThhalv10022550m
Vitis viniferaGSVIVT01022353001GSVIVT01008835001GSVIVT01008834001GSVIVT01024031001
Zea maysAC234152.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)