y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.009G169500.1
FamilyGT48
Protein PropertiesLength: 345 Molecular Weight: 39033.6 Isoelectric Point: 9.4587
ChromosomeChromosome/Scaffold: 09 Start: 24767081 End: 24770158
Descriptionglucan synthase-like 8
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT4811980
  MQLQLCSVFFTFSLGTRTHYFGRTILHGGAKYRATGRGFVVRHIKFAENYRLYSRSHFVKALEVALLLIVYIAYGYAEGGAVTYILVTLSSWFLVISWLF
  APYIFNPSGFEWQKTVEDFDDWTSWLLYKGGVGVKGENSWESWWDEEQMHIQTLRGRILETILSARFFLFQYGIVYKLHLTGNDTSLAVYGFSWAVLV
Full Sequence
Protein Sequence     Length: 345     Download
MQLQLCSVFF TFSLGTRTHY FGRTILHGGA KYRATGRGFV VRHIKFAENY RLYSRSHFVK    60
ALEVALLLIV YIAYGYAEGG AVTYILVTLS SWFLVISWLF APYIFNPSGF EWQKTVEDFD    120
DWTSWLLYKG GVGVKGENSW ESWWDEEQMH IQTLRGRILE TILSARFFLF QYGIVYKLHL    180
TGNDTSLAVY GFSWAVLVGI VLIFKIFTYS PKKSADFHLV LRFSQGVASI GLVTAVCLVV    240
AFTSLSIADL FASILAFIPT GWGILSLAIA WRKIIWSLGL WDSVREFARM YDAGMGMIIF    300
APIAFLSWFP FISTFQSRLL FNQAFSRGLE ISIILAGNKA NVEA*                    360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02364Glucan_synthase8.0e-451209236+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM20585.10134193433putative glucan synthase [Arabidopsis thaliana]
EMBLCBI14881.10134413511694unnamed protein product [Vitis vinifera]
RefSeqNP_001056596.10134445388Os06g0112800 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002322219.10134315571899predicted protein [Populus trichocarpa]
RefSeqXP_002511263.10134315261875transferase, transferring glycosyl groups, putative [Ricinus communis]
Transmembrane Domains
StartEnd
5877
82104
186208
223245
250272
287309
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT03668034113410
DY82535629312930
HO79678134113410
FE6959492421043450
DT46679226772730
Orthologous Group
SpeciesID
Carica papayaevm.model.supercontig_50.99
Citrus clementinaCiclev10015387m
Glycine maxGlyma12g12750.1
Gossypium raimondiiGorai.007G332800.1
Linum usitatissimumLus10000830Lus10014601
Malus domesticaMDP0000542728MDP0000624875MDP0000695519MDP0000138855
Manihot esculentacassava4.1_007052m
Oryza sativaLOC_Os06g02260.2LOC_Os06g02260.1
Panicum virgatumPavirv00049629mPavirv00005035mPavirv00035379mPavirv00002017mPavirv00014599m
Pavirv00001511m
Picea abiesMA_40978g0030MA_111976g0010MA_10432652g0010MA_8263680g0010MA_10437131g0040
Setaria italicaSi032541m
Selaginella moellendorffii427055
Sorghum bicolorSb01g049270.1Sb01g050470.1
Thellungiella halophilaThhalv10029468m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny