y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.009G191800.1
FamilyGT76
Protein PropertiesLength: 491 Molecular Weight: 55342.8 Isoelectric Point: 8.9812
ChromosomeChromosome/Scaffold: 09 Start: 28387842 End: 28390878
Descriptiontransferases, transferring hexosyl groups
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT76264900
  VLKSAIFSRLLLLAMIILFRTLLSPYDTSASLNPPCLTTPNATLSSPLQNAVVWDSVYFLRIAQCGYEYEQTFAFLPLLPLSLSLLSFLPTLFILSAYLI
  NNLAFVLAALYFYRLSLTLLKDPQIALRATLLFCFNPASVFYSSIYSESLYALMCFGGMYHFVCGGNNLAVLFFALSGCARSNGVLNAGYLCFQTMHRSF
  HALFHQKRLPLALQIIFVGALRTACVFAPFLAFLAYGYYNMCVGRSHDDIRPWCKARIPLLYSYIQSNYWGVGFLRYFQLKQLPNFLLASPILSLALCSI
  VHYAKSRPQTFFSLGFLAPMEEKSCGVVFLSGDLSRSKEAGSVGKSSSVRVEEHLNLRRRKNVIKGDVATVPIESESAEAWPGYLSASVLPFLLHLGFMA
  STAFFVMHVQVATRFLSANPPLYWFAAYIMAYPTKYYRWGYVIWAYSITYIFLGSLLFSNFYPFT
Full Sequence
Protein Sequence     Length: 491     Download
MRGDSHSKMV ETSAEHEHEH LHQHLVLKSA IFSRLLLLAM IILFRTLLSP YDTSASLNPP    60
CLTTPNATLS SPLQNAVVWD SVYFLRIAQC GYEYEQTFAF LPLLPLSLSL LSFLPTLFIL    120
SAYLINNLAF VLAALYFYRL SLTLLKDPQI ALRATLLFCF NPASVFYSSI YSESLYALMC    180
FGGMYHFVCG GNNLAVLFFA LSGCARSNGV LNAGYLCFQT MHRSFHALFH QKRLPLALQI    240
IFVGALRTAC VFAPFLAFLA YGYYNMCVGR SHDDIRPWCK ARIPLLYSYI QSNYWGVGFL    300
RYFQLKQLPN FLLASPILSL ALCSIVHYAK SRPQTFFSLG FLAPMEEKSC GVVFLSGDLS    360
RSKEAGSVGK SSSVRVEEHL NLRRRKNVIK GDVATVPIES ESAEAWPGYL SASVLPFLLH    420
LGFMASTAFF VMHVQVATRF LSANPPLYWF AAYIMAYPTK YYRWGYVIWA YSITYIFLGS    480
LLFSNFYPFT *                                                         540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04188Mannosyl_trans26.0e-1341349086+
COG5542COG55421.0e-14124318198+
pfam04188Mannosyl_trans28.0e-8230331317+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0006506GPI anchor biosynthetic process
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAC17633.1074902492Contains similarity to hypothetical protein C18b11.05 gb
GenBankABC75356.1094901486Protein of unknown function DUF409 [Medicago truncatula]
RefSeqNP_172652.2074902489transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002283435.102249011497PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002304011.10174906483predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
3049
116138
150172
182201
208225
240262
310329
409431
440457
467489
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CV5336022511223720
HO7830321841713540
HO7830321333134450
DV1444202261223470
BE1903771882824690
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00449.3Aquca_013_00449.2Aquca_013_00449.1
Arabidopsis lyrata471336
Arabidopsis thalianaAT1G11880.1
Brachypodium distachyonBradi4g06960.1
Brassica rapaBra031787Bra016807
Carica papayaevm.model.supercontig_1833.2
Capsella rubellaCarubv10008966m
Chlamydomonas reinhardtiiCre07.g320650.t1.3
Citrus clementinaCiclev10015009m
Citrus sinensisorange1.1g018572morange1.1g020868morange1.1g022022morange1.1g011059m
Cucumis sativusCucsa.142860.1Cucsa.142850.1
Eucalyptus grandisEucgr.F02225.1
Fragaria vescamrna24756.1-v1.0-hybrid
Glycine maxGlyma07g34710.2Glyma07g34710.1
Gossypium raimondiiGorai.011G002800.4.154.470Gorai.011G002800.6Gorai.011G002800.3Gorai.011G002800.2Gorai.011G002800.4.154.470
Gorai.011G002800.5Gorai.011G002800.4.21.155Gorai.011G002800.1Gorai.011G002800.4.21.155
Linum usitatissimumLus10000535
Malus domesticaMDP0000302238MDP0000268496MDP0000210920MDP0000206274MDP0000255613
MDP0000165902
Manihot esculentacassava4.1_021982mcassava4.1_013936m
Medicago truncatulaMedtr4g084070.1
Mimulus guttatusmgv1a006152m
Oryza sativaLOC_Os12g31480.1
Panicum virgatumPavirv00004639mPavirv00008794m
Physcomitrella patensPp1s58_115V6.1
Phaseolus vulgarisPhvul.002G098000.2Phvul.002G098000.1
Picea abiesMA_93868g0010MA_10427477g0010
Populus trichocarpaPotri.003G216900.1Potri.003G216900.3Potri.003G216900.2Potri.003G216900.4Potri.003G216900.5
Prunus persicappa004654m
Ricinus communis29692.m000527
Setaria italicaSi021856m
Selaginella moellendorffii268247
Sorghum bicolorSb03g024000.1
Thellungiella halophilaThhalv10007452m
Vitis viniferaGSVIVT01025407001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny