y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.009G222700.1
FamilyCE8
Protein PropertiesLength: 535 Molecular Weight: 58305.1 Isoelectric Point: 8.329
ChromosomeChromosome/Scaffold: 09 Start: 32995004 End: 32998545
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82275170
  AIVAQDGSGNYKTVSDAIKAASGKRFVIYVKEGIYKEKIRTSKDGITLVGDGKYSTLIVGDDSVAKGSILPDSATFTITGDGFIARDIGFQNNAGPQGEQ
  AVALNMASDRSVLYRCSIAGYQDTLYAHALRQFYAECDIYGTIDFIFGNAAAVFQRCNILLRRPRGSSYNVILANGRTDPGQNTGFSIHKCSISATSDFS
  SVKHSYGSFLGRPWKEYSRAVVMESRIDDTIAARGWVEWPGYGSSVLKNLYFAEYGNEGAGAGTAKRVQWQGFRVLQPQEAGKFTVATFIA
Full Sequence
Protein Sequence     Length: 535     Download
MDKISHCCLF LHLGLRIPQL VVTLLVLGRA LSWLTISDAH NECSLTRYPN LCAETLMQSG    60
SSNHTVDNIL ALVNKTILET NLPSSYFAEF KTADAHVAHS VVADYCEELM SMSLKRLDQS    120
LRALKSPGRN NNDIQTWLSA SLTFQQSCKD YAHAHATVLS ADGLMQRMCN KMEFLSQLGS    180
NSLALVNHMS TKASHKVGTN EEEDEFPKWV SAKGRKLLQG GTIKANAIVA QDGSGNYKTV    240
SDAIKAASGK RFVIYVKEGI YKEKIRTSKD GITLVGDGKY STLIVGDDSV AKGSILPDSA    300
TFTITGDGFI ARDIGFQNNA GPQGEQAVAL NMASDRSVLY RCSIAGYQDT LYAHALRQFY    360
AECDIYGTID FIFGNAAAVF QRCNILLRRP RGSSYNVILA NGRTDPGQNT GFSIHKCSIS    420
ATSDFSSVKH SYGSFLGRPW KEYSRAVVME SRIDDTIAAR GWVEWPGYGS SVLKNLYFAE    480
YGNEGAGAGT AKRVQWQGFR VLQPQEAGKF TVATFIAGNS WIPSTGVTFI SGLN*         540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02484PLN024842.0e-14243534513+
PLN02468PLN024684.0e-143106533441+
PLN02301PLN023011.0e-149106533437+
pfam01095Pectinesterase3.0e-154226519300+
PLN02698PLN02698029533511+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK24761.104353356555unknown [Picea sitchensis]
GenBankABK24883.104353369568unknown [Picea sitchensis]
RefSeqNP_197586.102951225489pectinesterase family protein [Arabidopsis thaliana]
RefSeqXP_002277293.104053410480PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002516196.10265339526Pectinesterase-2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A02235331315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A02225334319A Chain A, Pectin Methylesterase From Carrot
PDB1qjv_B3e-222265245340A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A3e-222265245340A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB2ntq_B5e-222265245340A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EY6632392582004570
CX6360302682355020
EE2553242472895350
DT7555542551944480
DR9307502541944470
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00025.1Aquca_020_00595.1
Arabidopsis lyrata326467
Arabidopsis thalianaAT5G20860.1
Brassica rapaBra020131
Carica papayaevm.model.supercontig_344.3
Capsella rubellaCarubv10003708m
Citrus clementinaCiclev10007964m
Citrus sinensisorange1.1g011489morange1.1g009545morange1.1g011611morange1.1g009418morange1.1g009682m
Eucalyptus grandisEucgr.C00760.1
Fragaria vescamrna12962.1-v1.0-hybrid
Glycine maxGlyma09g08900.2
Gossypium raimondiiGorai.001G018200.1
Linum usitatissimumLus10017665Lus10033621Lus10025510
Malus domesticaMDP0000545023.761.939MDP0000545023.761.939
Manihot esculentacassava4.1_005313mcassava4.1_005427m
Mimulus guttatusmgv1a024664mmgv1a004362m
Picea abiesMA_10435891g0010
Populus trichocarpaPotri.006G135100.1Potri.006G135100.2
Prunus persicappa016574m
Ricinus communis29739.m003679
Thellungiella halophilaThhalv10013149m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny