y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.009G261000.1
FamilyGT68
Protein PropertiesLength: 530 Molecular Weight: 60494.5 Isoelectric Point: 8.3687
ChromosomeChromosome/Scaffold: 09 Start: 37323053 End: 37325604
DescriptionO-fucosyltransferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT681905040
  NHLMCLQKHMFFAALLNRVLVIPSSKVDYEYERVLDVEHMNRCAGGKVKAVISFQEFSSMKKNGMHEGKFLCYFSLPRPCYLDDEHLRKLKSLGLLSTNK
  PAAAWDEDARKPRKRSVEEVVSRFSREEKEDVLVIGDVLYADVEEEWVTQAGGPLAHRCKTLIQPNRLIFLTAQRFIQTFLGRNFLALHFRRHDFLNFCN
  GKKPSCFYPIPQAAACILRVVERANAPLIYLSTDAAESEIRLLQSLLVLEGRHVPLVKRPPRNSAEKWDALLYRHHIEGDPQVEAMLDKTICAMSSVFIG
  ASGSTFTQDIRRLRK
Full Sequence
Protein Sequence     Length: 530     Download
MERDSSSDEE EELIHQKQGN APRSPSSFHF QSLTSRITSN FNFNFKFPFQ KRYLFAILPL    60
FAILLYYLLP DSHSLFSLSS VNLNLRHDQP EESQLRALYL LRQQQSGLLH ALNSTSQTHI    120
LKSLLSNQIS LNSQIQHLLL SPYTTATSLH FRNAACGTVD QKLLERRTME WKPKANKFLV    180
AVCVSGQMSN HLMCLQKHMF FAALLNRVLV IPSSKVDYEY ERVLDVEHMN RCAGGKVKAV    240
ISFQEFSSMK KNGMHEGKFL CYFSLPRPCY LDDEHLRKLK SLGLLSTNKP AAAWDEDARK    300
PRKRSVEEVV SRFSREEKED VLVIGDVLYA DVEEEWVTQA GGPLAHRCKT LIQPNRLIFL    360
TAQRFIQTFL GRNFLALHFR RHDFLNFCNG KKPSCFYPIP QAAACILRVV ERANAPLIYL    420
STDAAESEIR LLQSLLVLEG RHVPLVKRPP RNSAEKWDAL LYRHHIEGDP QVEAMLDKTI    480
CAMSSVFIGA SGSTFTQDIR RLRKDWGSAS LCDEYLCQGE EPNVVAEIE*               540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam10250O-FucT0.0008201503329+
cd11302O-FucT-10.0003352504178+
cd11296O-FucT_like0.000217822144+
cd11298O-FucT-26.0e-10370500133+
cd11296O-FucT_like6.0e-20343503176+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM66093.1015291566unknown [Arabidopsis thaliana]
RefSeqNP_173170.201952942564unknown protein [Arabidopsis thaliana]
RefSeqNP_199853.1015291566unknown protein [Arabidopsis thaliana]
RefSeqXP_002264087.1015291559PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002303337.109252972527predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4ap5_B0.002370504263377A Chain A, Crystal Structure Of Human Pofut2
PDB4ap5_A0.002370504263377A Chain A, Crystal Structure Of Human Pofut2
PDB4ap6_D0.002370504277391A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap6_C0.002370504277391A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
PDB4ap6_B0.002370504277391A Chain A, Crystal Structure Of Human Pofut2 E54a Mutant In Complex With Gdp- Fucose
Transmembrane Domains
StartEnd
5370
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8818723551735270
HO7868031802444220
HO7868031411072470
ES8502683321664950
HO786803264124370.14
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00900.1Aquca_013_00900.2
Arabidopsis lyrata918074889130474511
Arabidopsis thalianaAT5G50420.1AT1G17270.1AT1G53770.2AT1G53770.1
Brachypodium distachyonBradi1g23980.1
Brassica rapaBra039691Bra016609Bra022515
Carica papayaevm.model.supercontig_25.202
Capsella rubellaCarubv10008736mCarubv10026161mCarubv10008696m
Citrus clementinaCiclev10025289m
Citrus sinensisorange1.1g008526m
Cucumis sativusCucsa.088930.1Cucsa.149140.2Cucsa.088930.2Cucsa.149140.1
Eucalyptus grandisEucgr.J02587.1Eucgr.I02168.1
Fragaria vescamrna05486.1-v1.0-hybrid
Glycine maxGlyma16g01730.1Glyma07g05200.1
Gossypium raimondiiGorai.010G172800.1Gorai.006G090800.1Gorai.011G054400.1
Linum usitatissimumLus10037461Lus10003929
Malus domesticaMDP0000692823MDP0000881647MDP0000203531
Manihot esculentacassava4.1_004684m
Medicago truncatulaMedtr8g023490.1
Mimulus guttatusmgv1a003863m
Oryza sativaLOC_Os07g38490.1
Panicum virgatumPavirv00005372mPavirv00007596m
Physcomitrella patensPp1s149_19V6.1
Phaseolus vulgarisPhvul.010G122400.1
Picea abiesMA_10437033g0010
Populus trichocarpaPotri.003G073500.5Potri.003G073500.1Potri.003G073500.2Potri.003G073500.3Potri.003G073500.4
Potri.003G073500.6
Prunus persicappa004150m
Ricinus communis29884.m000188
Setaria italicaSi029376m
Selaginella moellendorffii146424410382
Sorghum bicolorSb02g037060.1
Thellungiella halophilaThhalv10013133mThhalv10007186mThhalv10011359m
Vitis viniferaGSVIVT01016658001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny