y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.010G045600.2
FamilyGT22
Protein PropertiesLength: 500 Molecular Weight: 57708.5 Isoelectric Point: 9.0212
ChromosomeChromosome/Scaffold: 10 Start: 6903806 End: 6925958
Descriptionhomolog of asparagine-linked glycosylation 12
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22493840
  LLASIAALYVLTIPYTKVEESFNVQAMHDILYHWTNLENYDHLEFPGVVPRTFLVRMALGCIILYTLRFFRHQIRNKFGHQVEAFFVILTAIQFHFLFYC
  TRPLPNILALGLVNLAYGYWFEGRFYAALNSLIFATTVFRCDMLLLLCSIGLQLLLTNKISVWGALKHCTGMALFCIGLTIIVDSIMWKRLLWPEFEVFW
  FNSVLNKSSEWGTNAFHWYFTSALPRSLLAAYPLSLFGLFLDRRVRTFTFPVLAFILLYSKLPHKELRFIISSVPIFNVSASIASNRIYNNRKKMIWNLL
  FLILLALLLVSLAGTITSFMASYWNYPSGYALKELH
Full Sequence
Protein Sequence     Length: 500     Download
MKAQFFRKAH KLISCLSSLF CIHSATNRTT MASNSKSETF LQRYGYDLLL ASIAALYVLT    60
IPYTKVEESF NVQAMHDILY HWTNLENYDH LEFPGVVPRT FLVRMALGCI ILYTLRFFRH    120
QIRNKFGHQV EAFFVILTAI QFHFLFYCTR PLPNILALGL VNLAYGYWFE GRFYAALNSL    180
IFATTVFRCD MLLLLCSIGL QLLLTNKISV WGALKHCTGM ALFCIGLTII VDSIMWKRLL    240
WPEFEVFWFN SVLNKSSEWG TNAFHWYFTS ALPRSLLAAY PLSLFGLFLD RRVRTFTFPV    300
LAFILLYSKL PHKELRFIIS SVPIFNVSAS IASNRIYNNR KKMIWNLLFL ILLALLLVSL    360
AGTITSFMAS YWNYPSGYAL KELHGIGFHN DTDEQLVHID TFSAMNGISR FCESDLPWRY    420
SKEEQISLEE FHHRNFTFLI NEHPVINGFK CLFTEDGFSR VRLKSGFPPI LLVKEPKVYV    480
HGSLENQNIV SQNWSGCSL*                                                540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02816PLN028162.0e-7225324100+
pfam03901Glyco_transf_222.0e-2658342325+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001077446.10314971493transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_001077448.10314971497transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002271419.10624983469PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002301238.10354983479predicted protein [Populus trichocarpa]
RefSeqXP_002526470.1035485121596glycosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
4466
96118
131153
173195
208230
266288
344366
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG9923952541834360
EG4923072841043870
EL435541333673700
EG4646052712194880
ES4360903011514510
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_053_00061.1Aquca_053_00061.4Aquca_053_00061.3Aquca_053_00061.5Aquca_053_00061.6
Aquca_053_00061.2
Arabidopsis lyrata887214
Arabidopsis thalianaAT1G02145.1AT1G02145.2AT1G02145.4AT1G02145.3
Brachypodium distachyonBradi5g17390.1
Brassica rapaBra032669
Capsella rubellaCarubv10011809m
Citrus clementinaCiclev10019843m
Citrus sinensisorange1.1g010983morange1.1g010929m
Cucumis sativusCucsa.362500.1Cucsa.362500.2Cucsa.362500.8
Eucalyptus grandisEucgr.E01545.1Eucgr.E01545.2
Fragaria vescamrna05309.1-v1.0-hybrid
Glycine maxGlyma07g13150.1Glyma03g25680.2Glyma03g25680.1
Gossypium raimondiiGorai.004G166900.2Gorai.004G166900.4Gorai.004G166900.1Gorai.004G166900.3
Linum usitatissimumLus10019399Lus10043256
Malus domesticaMDP0000237340.174.306MDP0000237340.174.306
Manihot esculentacassava4.1_007438m
Medicago truncatulaAC202489_19.1
Mimulus guttatusmgv1a005831m
Oryza sativaLOC_Os04g46050.3LOC_Os04g46050.1LOC_Os04g46050.2
Panicum virgatumPavirv00060929m
Physcomitrella patensPp1s33_69V6.2
Phaseolus vulgarisPhvul.010G045600.4Phvul.010G045600.3Phvul.010G045600.1
Populus trichocarpaPotri.002G139200.1
Ricinus communis29709.m001172
Setaria italicaSi029826m
Selaginella moellendorffii91475
Sorghum bicolorSb06g024210.1
Thellungiella halophilaThhalv10007744mThhalv10007738mThhalv10007459m
Vitis viniferaGSVIVT01018298001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny