y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.010G045600.4
FamilyGT22
Protein PropertiesLength: 366 Molecular Weight: 41931.7 Isoelectric Point: 9.7286
ChromosomeChromosome/Scaffold: 10 Start: 6915501 End: 6925958
Descriptionhomolog of asparagine-linked glycosylation 12
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22493640
  LLASIAALYVLTIPYTKVEESFNVQAMHDILYHWTNLENYDHLEFPGVVPRTFLGALLVSIIAAPFVLTASLLHLPKFYALVIVRMALGCIILYTLRFFR
  HQIRNKFGHQVEAFFVILTAIQFHFLFYCTRPLPNILALGLVNLAYGYWFEGRFYAALNSLIFATTVFRCDMLLLLCSIGLQLLLTNKISVWGALKHCTG
  MALFCIGLTIIVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTNAFHWYFTSALPRSLLAAYPLSLFGLFLDRRVRTFTFPVLAFILLYSKLPHKELRFII
  SSVPIFNVSASIASNR
Full Sequence
Protein Sequence     Length: 366     Download
MKAQFFRKAH KLISCLSSLF CIHSATNRTT MASNSKSETF LQRYGYDLLL ASIAALYVLT    60
IPYTKVEESF NVQAMHDILY HWTNLENYDH LEFPGVVPRT FLGALLVSII AAPFVLTASL    120
LHLPKFYALV IVRMALGCII LYTLRFFRHQ IRNKFGHQVE AFFVILTAIQ FHFLFYCTRP    180
LPNILALGLV NLAYGYWFEG RFYAALNSLI FATTVFRCDM LLLLCSIGLQ LLLTNKISVW    240
GALKHCTGMA LFCIGLTIIV DSIMWKRLLW PEFEVFWFNS VLNKSSEWGT NAFHWYFTSA    300
LPRSLLAAYP LSLFGLFLDR RVRTFTFPVL AFILLYSKLP HKELRFIISS VPIFNVSASI    360
ASNRM*                                                               420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02816PLN028162.0e-7254365112+
pfam03901Glyco_transf_228.0e-2858365324+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001077446.10313651331transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_001077448.10313651335transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002301238.10353653340predicted protein [Populus trichocarpa]
RefSeqXP_002448266.104736522340hypothetical protein SORBIDRAFT_06g024210 [Sorghum bicolor]
RefSeqXP_002526470.1035365121451glycosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
4466
100122
129147
157176
181198
213235
248265
295317
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EL435541299673650
EC955568270443130
FS325042235292610
DW080631276303050
GE633896272353060
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_053_00061.1Aquca_053_00061.4Aquca_053_00061.3Aquca_053_00061.5Aquca_053_00061.6
Aquca_053_00061.2
Arabidopsis lyrata887214
Arabidopsis thalianaAT1G02145.1AT1G02145.2AT1G02145.4AT1G02145.3
Brachypodium distachyonBradi5g17390.1
Brassica rapaBra032669
Capsella rubellaCarubv10011809m
Citrus clementinaCiclev10019843m
Citrus sinensisorange1.1g010983morange1.1g010929m
Cucumis sativusCucsa.362500.1Cucsa.362500.2Cucsa.362500.8
Eucalyptus grandisEucgr.E01545.1Eucgr.E01545.2
Fragaria vescamrna05309.1-v1.0-hybrid
Glycine maxGlyma07g13150.1Glyma03g25680.2Glyma03g25680.1
Gossypium raimondiiGorai.004G166900.2Gorai.004G166900.4Gorai.004G166900.1Gorai.004G166900.3
Linum usitatissimumLus10019399Lus10043256
Malus domesticaMDP0000237340.174.306MDP0000237340.174.306
Manihot esculentacassava4.1_007438m
Medicago truncatulaAC202489_19.1
Mimulus guttatusmgv1a005831m
Oryza sativaLOC_Os04g46050.3LOC_Os04g46050.1LOC_Os04g46050.2
Panicum virgatumPavirv00060929m
Physcomitrella patensPp1s33_69V6.2
Phaseolus vulgarisPhvul.010G045600.2Phvul.010G045600.3Phvul.010G045600.1
Populus trichocarpaPotri.002G139200.1
Ricinus communis29709.m001172
Setaria italicaSi029826m
Selaginella moellendorffii91475
Sorghum bicolorSb06g024210.1
Thellungiella halophilaThhalv10007744mThhalv10007738mThhalv10007459m
Vitis viniferaGSVIVT01018298001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny