y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.010G080000.1
FamilyCE8
Protein PropertiesLength: 388 Molecular Weight: 43093.5 Isoelectric Point: 7.8967
ChromosomeChromosome/Scaffold: 10 Start: 29838810 End: 29843918
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE83003711.3e-23
  TYLGRPWKQYSRTVFMKTYLDGLINPAGWLEWSEYMNTDPGSSTARRVKWKVFRVMTMASEASKFIVANFIT
CE81462970
  LVAKDGSAKYTIVSAAINAAPKSSSGMYVIYVKSGVYNEQVEIKAKNIMLVGDGIGKTIIIGSKSVGGGITTFRSATVVVLGDGFVAQAITFRNTAGAEN
  HQVVALCSGSDLSVFYKCSFEGYQDTLYVHYDRNFYRECDIYGTIDFIFGNV
Full Sequence
Protein Sequence     Length: 388     Download
MACFCLLLPL FIAFQLLSFI SCYSLNFGAT KLQTLNHCGN PRETTAWANC VELYEQTIRK    60
LNETLDPNID YSQVDAQAWL STTLTNLEAC KAGFYDLGVQ DYVLPFMSNN VTKLLSSTLA    120
LNKVQYEEPI YKDGFPTWVK PSDRKLVAKD GSAKYTIVSA AINAAPKSSS GMYVIYVKSG    180
VYNEQVEIKA KNIMLVGDGI GKTIIIGSKS VGGGITTFRS ATVVVLGDGF VAQAITFRNT    240
AGAENHQVVA LCSGSDLSVF YKCSFEGYQD TLYVHYDRNF YRECDIYGTI DFIFGNVVVT    300
YLGRPWKQYS RTVFMKTYLD GLINPAGWLE WSEYMNTDPG SSTARRVKWK VFRVMTMASE    360
ASKFIVANFI TGNTWLPSTI VPFISPL*                                       420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02995PLN029953.0e-9337387446+
PLN02301PLN023017.0e-9540383432+
PLN02468PLN024684.0e-9545387435+
PLN02170PLN021702.0e-9549387428+
pfam01095Pectinesterase2.0e-106147373295+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN76835.103838767497hypothetical protein [Vitis vinifera]
EMBLCAN83663.103838782512hypothetical protein [Vitis vinifera]
EMBLCBI24285.103838714444unnamed protein product [Vitis vinifera]
RefSeqXP_002265599.103838782512PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002280446.103838783513PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A014638310315A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A01463876315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_B4e-1615529618180B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_A4e-1615529618180B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntp_B4e-1615529618180B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY292300273372990
EL453285282383010
AW257370220932990
EL455969282383010
GT691295266402890
Orthologous Group
SpeciesID
Eucalyptus grandisEucgr.E01455.1
Phaseolus vulgarisPhvul.010G080000.1.146.297Phvul.010G080000.1.146.297
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny