y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.010G092400.1
FamilyGH16
Protein PropertiesLength: 247 Molecular Weight: 27494.5 Isoelectric Point: 5.1511
ChromosomeChromosome/Scaffold: 10 Start: 34051286 End: 34052226
Descriptionendoxyloglucan transferase A3
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH16782101.1e-21
  GGARWRTPTRFHSGFFSALIKCPEGDTNGLNFNLYLSSQEGDKSQDEIDFEFLGRDRTLVQTNFFSGGAGNNERIHHLGFDASEGFHEYAIAWGRQTIEW
  RVDGEVVRREERKEGEGFPEKAMFLYASIWNAS
Full Sequence
Protein Sequence     Length: 247     Download
MDALRAESPA RQRPNAYSLS AYISISSCNT THTPTMADAL PLSHATQQLK QIAIDYTPEA    60
CSHCAISDTI TLTYDIRGGA RWRTPTRFHS GFFSALIKCP EGDTNGLNFN LYLSSQEGDK    120
SQDEIDFEFL GRDRTLVQTN FFSGGAGNNE RIHHLGFDAS EGFHEYAIAW GRQTIEWRVD    180
GEVVRREERK EGEGFPEKAM FLYASIWNAS GISDGKWCGK YCGADEPYVC VYKDIRVPVA    240
TAVDHE*                                                              300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02183GH16_fungal_CRH1_transglycosylase9.0e-11122237128+
PLN03161PLN031613.0e-1368209148+
cd02175GH16_lichenase7.0e-2870225163+
pfam00722Glyco_hydro_169.0e-3266210146+
cd02176GH16_XET3.0e-3269210148+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY88289.10242463226hypothetical protein OsI_09745 [Oryza sativa Indica Group]
RefSeqNP_001048767.10242463226Os03g0117300 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001150346.104624020215xyloglucan endotransglucosylase/hydrolase protein 5 [Zea mays]
RefSeqXP_002273975.10362441208PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002301319.10362441208predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vh9_B8e-256923762234A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB2vh9_A8e-256923762234A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB2uwb_B1e-246923739211A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB2uwb_A1e-246923739211A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB2uwc_B5e-236923738215A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX304374205392430
FS287857213352440
JG010818199462440
CO979719202322330
CN184882210362440
Orthologous Group
SpeciesID
Citrus clementinaCiclev10022200m
Citrus sinensisorange1.1g028023m
Eucalyptus grandisEucgr.D02237.1
Fragaria vescamrna18893.1-v1.0-hybrid
Glycine maxGlyma07g08550.2
Gossypium raimondiiGorai.007G095000.2Gorai.007G095000.1
Manihot esculentacassava4.1_016069m
Physcomitrella patensPp1s24_272V6.1Pp1s353_23V6.6Pp1s353_23V6.1Pp1s353_23V6.2Pp1s353_23V6.3
Pp1s353_23V6.4Pp1s353_23V6.5
Picea abiesMA_52109g0010
Populus trichocarpaPotri.002G153200.1
Prunus persicappa027011m
Setaria italicaSi039715m
Selaginella moellendorffii75086
Sorghum bicolorSb01g049420.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny