y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.011G057700.2
FamilyGH127
Protein PropertiesLength: 860 Molecular Weight: 96305 Isoelectric Point: 5.6943
ChromosomeChromosome/Scaffold: 11 Start: 4957673 End: 4963887
DescriptionPutative glycosyl hydrolase of unknown function (DUF1680)
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1273506325.6e-21
  TGDPLSKDIGTFFMETINSSHSYATGGTSVGEFWRDPKRIADTLKTTENEESCTTYNMLKVSRHLFRWTKEVSYADYYERALINGVLSIQRGTDPGVMIY
  MLPLGLGVSKAITFHGWGTPFDTFWCCYGTGIESFSKLGDSIYFEEEGKNPTLYVIQYISSSFNWKSGKLLLNQTVVPAASWDPYLRVTFTFSPFEKVLS
  DDENTWSALNFRLPTWTSLDGAKGILNGETLSLPAPGNYLSITRQWSASDNLTLQLPLTTRTEAIKDDRPEYASIHAILYGPY
Full Sequence
Protein Sequence     Length: 860     Download
MKGFVSVFVV LVLCGCAVAK ECTNIPTQSH TLMYELLSSK NETWKEEMMS HFHLTPTDES    60
AWADLLPRKF LSERQQHDWA VMYKKIKNMG VFQSPEGFLK DVPLEDVRLH EYSIHGIAQQ    120
TNLEYLLMFD VDRLIWSFRK TAGLPTPAAP YGGWEEPGCE LRGHFVGHYL SASALMWAST    180
QNDNLKQKMT SLVAGLSACQ EKIGTGYLSA FPSEFFDRVE AIKGVWAPYY TIHKILAGLL    240
DQYTFAGNSH ALNVVTWMVD YFYNRVQNVI TKYTINRHYQ SLNQETGGMN DVLYRLYSIT    300
EDSKHMLLAQ LFDKPCFLGL LAVQANDIAD MHANTHIPIV VGSQRRYEIT GDPLSKDIGT    360
FFMETINSSH SYATGGTSVG EFWRDPKRIA DTLKTTENEE SCTTYNMLKV SRHLFRWTKE    420
VSYADYYERA LINGVLSIQR GTDPGVMIYM LPLGLGVSKA ITFHGWGTPF DTFWCCYGTG    480
IESFSKLGDS IYFEEEGKNP TLYVIQYISS SFNWKSGKLL LNQTVVPAAS WDPYLRVTFT    540
FSPFEKVLSD DENTWSALNF RLPTWTSLDG AKGILNGETL SLPAPGNYLS ITRQWSASDN    600
LTLQLPLTTR TEAIKDDRPE YASIHAILYG PYLLAGHTLG GDWDLKSGAN TSEWITPIPE    660
SYNSQLVSFS QFFENSTFVL VNSNQSLGMQ KFPESGTDLA LQATFRLVPK ESSSKFSTLA    720
DANDRSVMLE PFDLPGMNVI HQGADKPLLI VDSSDGKPSS VFLVVPGLDG RNETISLESQ    780
SDKGCYVYSG LSSSAGVKLS CKSDSDATFN QATSFISQKG LSQYNALSFV AKGLNRNFLL    840
EPLFSFRDEH YTVYFNLKG*                                                900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3533COG35334.0e-6999636543+
pfam07944DUF16804.0e-161106635541+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_196799.102085825860catalytic [Arabidopsis thaliana]
RefSeqXP_002283032.101385992940PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002285548.1018581863PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002297785.1018591858predicted protein [Populus trichocarpa]
RefSeqXP_002304762.1018581857predicted protein [Populus trichocarpa]
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7810924114298390
GO8434393562996540
FE6817082925108010
ES803398309893970
HO781092238388601.2
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00256.1Aquca_009_00257.1
Arabidopsis lyrata350453909245488069
Arabidopsis thalianaAT5G12960.1AT5G12950.1
Brachypodium distachyonBradi1g36027.1
Brassica rapaBra006171Bra023384
Carica papayaevm.model.supercontig_84.84evm.model.supercontig_84.86
Capsella rubellaCarubv10000417mCarubv10000198m
Citrus clementinaCiclev10014240mCiclev10018011mCiclev10004509mCiclev10014230m
Citrus sinensisorange1.1g002872morange1.1g005721morange1.1g007445morange1.1g002940morange1.1g007459m
orange1.1g010393morange1.1g007406morange1.1g002978morange1.1g002973morange1.1g043003m
orange1.1g006861m
Cucumis sativusCucsa.065400.2Cucsa.065400.1
Eucalyptus grandisEucgr.B03672.1Eucgr.B03675.1Eucgr.B03677.1
Fragaria vescamrna20619.1-v1.0-hybrid
Glycine maxGlyma12g05980.1Glyma11g14020.2Glyma11g14020.1
Malus domesticaMDP0000306372MDP0000208326MDP0000125504
Manihot esculentacassava4.1_001514m
Medicago truncatulaMedtr4g065150.1
Mimulus guttatusmgv1a002509mmgv1a001146m
Oryza sativaLOC_Os02g10190.1LOC_Os06g41020.1
Panicum virgatumPavirv00026390m
Physcomitrella patensPp1s60_268V6.1
Phaseolus vulgarisPhvul.011G057700.1Phvul.011G057700.3Phvul.011G057800.1Phvul.005G149100.1Phvul.005G149100.2
Populus trichocarpaPotri.003G206000.2Potri.T087500.1Potri.003G206000.4Potri.003G206000.3Potri.003G206000.1
Potri.001G018200.1
Prunus persicappa001713m
Setaria italicaSi005995mSi016279mSi005830mSi016278m
Selaginella moellendorffii3065089765
Sorghum bicolorSb10g024070.1Sb04g006520.1
Thellungiella halophilaThhalv10012662m
Vitis viniferaGSVIVT01025310001GSVIVT01025321001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny