y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.011G057700.3
FamilyGH127
Protein PropertiesLength: 685 Molecular Weight: 76328 Isoelectric Point: 5.3687
ChromosomeChromosome/Scaffold: 11 Start: 4957673 End: 4963161
DescriptionPutative glycosyl hydrolase of unknown function (DUF1680)
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1271754573.5e-21
  TGDPLSKDIGTFFMETINSSHSYATGGTSVGEFWRDPKRIADTLKTTENEESCTTYNMLKVSRHLFRWTKEVSYADYYERALINGVLSIQRGTDPGVMIY
  MLPLGLGVSKAITFHGWGTPFDTFWCCYGTGIESFSKLGDSIYFEEEGKNPTLYVIQYISSSFNWKSGKLLLNQTVVPAASWDPYLRVTFTFSPFEKVLS
  DDENTWSALNFRLPTWTSLDGAKGILNGETLSLPAPGNYLSITRQWSASDNLTLQLPLTTRTEAIKDDRPEYASIHAILYGPY
Full Sequence
Protein Sequence     Length: 685     Download
MWASTQNDNL KQKMTSLVAG LSACQEKIGT GYLSAFPSEF FDRVEAIKGV WAPYYTIHKI    60
LAGLLDQYTF AGNSHALNVV TWMVDYFYNR VQNVITKYTI NRHYQSLNQE TGGMNDVLYR    120
LYSITEDSKH MLLAQLFDKP CFLGLLAVQA NDIADMHANT HIPIVVGSQR RYEITGDPLS    180
KDIGTFFMET INSSHSYATG GTSVGEFWRD PKRIADTLKT TENEESCTTY NMLKVSRHLF    240
RWTKEVSYAD YYERALINGV LSIQRGTDPG VMIYMLPLGL GVSKAITFHG WGTPFDTFWC    300
CYGTGIESFS KLGDSIYFEE EGKNPTLYVI QYISSSFNWK SGKLLLNQTV VPAASWDPYL    360
RVTFTFSPFE KVLSDDENTW SALNFRLPTW TSLDGAKGIL NGETLSLPAP GNYLSITRQW    420
SASDNLTLQL PLTTRTEAIK DDRPEYASIH AILYGPYLLA GHTLGGDWDL KSGANTSEWI    480
TPIPESYNSQ LVSFSQFFEN STFVLVNSNQ SLGMQKFPES GTDLALQATF RLVPKESSSK    540
FSTLADANDR SVMLEPFDLP GMNVIHQGAD KPLLIVDSSD GKPSSVFLVV PGLDGRNETI    600
SLESQSDKGC YVYSGLSSSA GVKLSCKSDS DATFNQATSF ISQKGLSQYN ALSFVAKGLN    660
RNFLLEPLFS FRDEHYTVYF NLKG*                                          720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3533COG35334.0e-551461466+
pfam07944DUF16806.0e-1341460469+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI16424.10168449733unnamed protein product [Vitis vinifera]
RefSeqXP_002283032.101684256940PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002285548.101683181863PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002297785.101684176858predicted protein [Populus trichocarpa]
RefSeqXP_002304762.101683176857predicted protein [Populus trichocarpa]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7810924112546640
GO8434393571244790
FE6817082923356260
CV5370722232134350
HO781092236636850.95
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00256.1Aquca_009_00257.1
Arabidopsis lyrata350453909245488069
Arabidopsis thalianaAT5G12960.1AT5G12950.1
Brachypodium distachyonBradi1g36027.1
Brassica rapaBra006171Bra023384
Carica papayaevm.model.supercontig_84.84evm.model.supercontig_84.86
Capsella rubellaCarubv10000417mCarubv10000198m
Citrus clementinaCiclev10014240mCiclev10018011mCiclev10004509mCiclev10014230m
Citrus sinensisorange1.1g002872morange1.1g005721morange1.1g007445morange1.1g002940morange1.1g007459m
orange1.1g010393morange1.1g007406morange1.1g002978morange1.1g002973morange1.1g043003m
orange1.1g006861m
Cucumis sativusCucsa.065400.2Cucsa.065400.1
Eucalyptus grandisEucgr.B03672.1Eucgr.B03675.1Eucgr.B03677.1
Fragaria vescamrna20619.1-v1.0-hybrid
Glycine maxGlyma12g05980.1Glyma11g14020.2Glyma11g14020.1
Malus domesticaMDP0000306372MDP0000208326MDP0000125504
Manihot esculentacassava4.1_001514m
Medicago truncatulaMedtr4g065150.1
Mimulus guttatusmgv1a002509mmgv1a001146m
Oryza sativaLOC_Os02g10190.1LOC_Os06g41020.1
Panicum virgatumPavirv00026390m
Physcomitrella patensPp1s60_268V6.1
Phaseolus vulgarisPhvul.011G057700.2Phvul.011G057700.1Phvul.011G057800.1Phvul.005G149100.1Phvul.005G149100.2
Populus trichocarpaPotri.003G206000.2Potri.T087500.1Potri.003G206000.4Potri.003G206000.3Potri.003G206000.1
Potri.001G018200.1
Prunus persicappa001713m
Setaria italicaSi005995mSi016279mSi005830mSi016278m
Selaginella moellendorffii3065089765
Sorghum bicolorSb10g024070.1Sb04g006520.1
Thellungiella halophilaThhalv10012662m
Vitis viniferaGSVIVT01025310001GSVIVT01025321001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny