y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.011G057800.1
FamilyGH127
Protein PropertiesLength: 851 Molecular Weight: 95405 Isoelectric Point: 6.0751
ChromosomeChromosome/Scaffold: 11 Start: 4968003 End: 4974688
DescriptionPutative glycosyl hydrolase of unknown function (DUF1680)
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1273516245.2e-22
  GDPLYKEIGTFFMDLVNSSHSYATGGTSVSEFWSNPKRIADNLGTTENEESCTTYNMLKVSRHLFKWTREVSYADYYERALTNGVLSIQRGTDPGVMIYM
  LPLGFGVSKAKTGHSWGTPLDSFWCCYGTGIESFSKLGDSIYFEEQGKDPSLYIIQYISSSFNWESGKILLNQKVVPASSWDPYLRVTFTFSPVESTSST
  LNFRLPSWTSLDGPKGILNDESLSLPTPGSFLSITREWSASDKLTLQLPLTVRTEAIKDDRPQYASVKAILYGP
Full Sequence
Protein Sequence     Length: 851     Download
MKAFLFVFVA LTLCGYAVAK ECTNIPTQSH TFRYELLTSK NATWREEVMS HYHLTPTDET    60
AWADLLPRKF LTEQNQHDWG MMYRQIKNTG VSKSPEGFLK EVPLGQVRLH EDSIHGRAQK    120
TNLEYLLMLD MDRLIWSFRK TAGLSTPGTP YGGWEGPGVE LRGHFVGHYL SASALMWAST    180
QDESLKQKMQ YLVAGLSTCQ EKIGTGYLSA FPSELFDRFE SVQQVWAPYY TIHKILAGLL    240
DQHIFAGNPQ ALKMVKWMVD YFYDRVHSVI TKYTINRHYE SLNEETGGMN DVLYKLYSIT    300
GDSKHLLLAH LFDKPCFLGL LAVQASDIAD FHANTHIPIV VGSQMRYEVT GDPLYKEIGT    360
FFMDLVNSSH SYATGGTSVS EFWSNPKRIA DNLGTTENEE SCTTYNMLKV SRHLFKWTRE    420
VSYADYYERA LTNGVLSIQR GTDPGVMIYM LPLGFGVSKA KTGHSWGTPL DSFWCCYGTG    480
IESFSKLGDS IYFEEQGKDP SLYIIQYISS SFNWESGKIL LNQKVVPASS WDPYLRVTFT    540
FSPVESTSST LNFRLPSWTS LDGPKGILND ESLSLPTPGS FLSITREWSA SDKLTLQLPL    600
TVRTEAIKDD RPQYASVKAI LYGPYLLAGH TSGGDWDIEA KNADWITPIP ASYNSQLVSF    660
FQDFEKSTFV LANSNQSLAM QKLPESGTDL ALRATFRLVL KESSSKFSTL ADAYGRSVML    720
EPFDLPGMNV IHQGEDKPLL IVDSSDGKPS SVFLMVPGLD GRNETISLES QSDKGCYVYG    780
ALSSSAGVKL SCKSDSDSSF KQATSFVARE GLNQYNPISF VAKGANKYFL LQPLFSFRDE    840
FYTVYFNIQD *                                                         900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3533COG35338.0e-7399635539+
pfam07944DUF16809.0e-165106628533+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_196799.102084925860catalytic [Arabidopsis thaliana]
RefSeqXP_002283032.101384992939PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002285548.1018501864PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002297785.1018491857predicted protein [Populus trichocarpa]
RefSeqXP_002304762.1018491857predicted protein [Populus trichocarpa]
Signal Peptide
Cleavage Site
19
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7810924024298300
FE6817082835107920
FE7101872734587300
GO8434393462996430
HO781092278258510.019
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00256.1Aquca_009_00257.1
Arabidopsis lyrata350453909245488069
Arabidopsis thalianaAT5G12960.1AT5G12950.1
Brachypodium distachyonBradi1g36027.1
Brassica rapaBra006171Bra023384
Carica papayaevm.model.supercontig_84.84evm.model.supercontig_84.86
Capsella rubellaCarubv10000417mCarubv10000198m
Citrus clementinaCiclev10014240mCiclev10018011mCiclev10004509mCiclev10014230m
Citrus sinensisorange1.1g002872morange1.1g005721morange1.1g007445morange1.1g002940morange1.1g007459m
orange1.1g010393morange1.1g007406morange1.1g002978morange1.1g002973morange1.1g043003m
orange1.1g006861m
Cucumis sativusCucsa.065400.2Cucsa.065400.1
Eucalyptus grandisEucgr.B03672.1Eucgr.B03675.1Eucgr.B03677.1
Fragaria vescamrna20619.1-v1.0-hybrid
Glycine maxGlyma12g05980.1Glyma11g14020.2Glyma11g14020.1
Malus domesticaMDP0000306372MDP0000208326MDP0000125504
Manihot esculentacassava4.1_001514m
Medicago truncatulaMedtr4g065150.1
Mimulus guttatusmgv1a002509mmgv1a001146m
Oryza sativaLOC_Os02g10190.1LOC_Os06g41020.1
Panicum virgatumPavirv00026390m
Physcomitrella patensPp1s60_268V6.1
Phaseolus vulgarisPhvul.011G057700.2Phvul.011G057700.1Phvul.011G057700.3Phvul.005G149100.1Phvul.005G149100.2
Populus trichocarpaPotri.003G206000.2Potri.T087500.1Potri.003G206000.4Potri.003G206000.3Potri.003G206000.1
Potri.001G018200.1
Prunus persicappa001713m
Setaria italicaSi005995mSi016279mSi005830mSi016278m
Selaginella moellendorffii3065089765
Sorghum bicolorSb10g024070.1Sb04g006520.1
Thellungiella halophilaThhalv10012662m
Vitis viniferaGSVIVT01025310001GSVIVT01025321001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny