y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.011G069900.1
FamilyGH18
Protein PropertiesLength: 307 Molecular Weight: 33870 Isoelectric Point: 5.5667
ChromosomeChromosome/Scaffold: 11 Start: 6110034 End: 6110954
Description
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH18612351.2e-21
  HFILSFAIDYDTSSSSPTNGKFNIFWDTDNLSPTQVSAIKAKNSNVKVALSLGGDSVGGGYAYFNPSSIDSWVSNAVSSLTAIIKEYNLDGIDIDYEHFK
  TDPQTFSECVGRLIKTLKSNGVIQFASIAPFDDPQVQSHYLALWKSYGSFIDYVNFQFYAYDKGTSVAQFIDYFN
Full Sequence
Protein Sequence     Length: 307     Download
MKFPITTFTL KPFFFLFILL TSTHAGTIST PTSNLFREYI GAEFNNVKFS DLPINPTVQF    60
HFILSFAIDY DTSSSSPTNG KFNIFWDTDN LSPTQVSAIK AKNSNVKVAL SLGGDSVGGG    120
YAYFNPSSID SWVSNAVSSL TAIIKEYNLD GIDIDYEHFK TDPQTFSECV GRLIKTLKSN    180
GVIQFASIAP FDDPQVQSHY LALWKSYGSF IDYVNFQFYA YDKGTSVAQF IDYFNTQSSN    240
YKGGKVLVSF ISDGSGGLAP NDGFFTACHT LKTQQNLHGI FVWSADDSMG NGFRYEKQSQ    300
ALLALP*                                                              360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02871GH18_chitinase_D-like8.0e-1063219171+
smart00636Glyco_187.0e-1095244155+
cd00598GH18_chitinase-like2.0e-1245219184+
pfam00704Glyco_hydro_183.0e-1561221169+
cd06544GH18_narbonin1.0e-12835288255+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN76732.1019306302587hypothetical protein [Vitis vinifera]
EMBLCAN76732.102828422278hypothetical protein [Vitis vinifera]
RefSeqXP_002281665.1023065303PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318148.10133063300predicted protein [Populus trichocarpa]
RefSeqXP_002532811.1023055303Chitinase 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3sim_B0353032273A Chain A, Crystallographic Structure Analysis Of Family 18 Chitinase From Crocus Vernus
PDB3sim_A0353032273A Chain A, Crystallographic Structure Analysis Of Family 18 Chitinase From Crocus Vernus
PDB1nar_A7e-37352894267A Chain A, Crystal Structure Of Narbonin Refined At 1.8 Angstroms Resolution
PDB3fnd_A0.00085622522174A Chain A, Crystal Structure Of Narbonin Refined At 1.8 Angstroms Resolution
PDB3co4_A0.00085622522174A Chain A, Crystal Structure Of A Chitinase From Bacteroides Thetaiotaomicron
Transmembrane Domains
StartEnd
1335
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY618350287223050
FQ317099268403060
FQ317071268403060
FQ316586268403060
EY794296250342820
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_046_00008.1Aquca_014_00353.1Aquca_010_00636.1Aquca_027_00184.1
Brachypodium distachyonBradi3g26850.1Bradi3g26810.1Bradi3g26840.1
Carica papayaevm.model.supercontig_139.6
Citrus clementinaCiclev10028881mCiclev10003729m
Citrus sinensisorange1.1g021511morange1.1g046094m
Eucalyptus grandisEucgr.B02439.1Eucgr.J02106.1
Fragaria vescamrna14033.1-v1.0-hybrid.59.211mrna14019.1-v1.0-hybridmrna15882.1-v1.0-hybridmrna14034.1-v1.0-hybridmrna17899.1-v1.0-hybrid
mrna22564.1-v1.0-hybrid
Glycine maxGlyma11g15512.1Glyma09g21615.1Glyma13g40590.1
Gossypium raimondiiGorai.003G135700.1Gorai.003G135800.1Gorai.003G134100.1Gorai.003G129600.1Gorai.011G120000.1
Gorai.003G138400.1
Linum usitatissimumLus10005172
Malus domesticaMDP0000904158MDP0000885802MDP0000644797MDP0000312089
Manihot esculentacassava4.1_024209mcassava4.1_027074m
Medicago truncatulaMedtr6g079630.1Medtr2g096030.1
Mimulus guttatusmgv1a019267mmgv1a024804m
Oryza sativaLOC_Os10g28050.1LOC_Os10g28080.1
Panicum virgatumPavirv00061810mPavirv00014582mPavirv00031712m
Picea abiesMA_38396g0010MA_10427109g0010
Populus trichocarpaPotri.012G102400.1Potri.015G100500.1Potri.015G100600.1Potri.001G341700.1
Prunus persicappa023801mppa009038mppa009096m
Ricinus communis30039.m00023530039.m000234
Setaria italicaSi022612mSi026720mSi028172mSi036765mSi036774m
Selaginella moellendorffii41118115493
Sorghum bicolorSb01g021920.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny