y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.011G093000.1
FamilyGT29
Protein PropertiesLength: 432 Molecular Weight: 49454.2 Isoelectric Point: 9.755
ChromosomeChromosome/Scaffold: 11 Start: 9416761 End: 9418935
DescriptionGlycosyltransferase family 29 (sialyltransferase) family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT292004100
  VVTNDKRKYSSCAVVGNSGILLNRDYGSEIDAHEAVIRLNNARVDHFETKVGKKTSISFMNSNILHLCARRAGCFCHPYGDHVPIVMYICQAVHFLDYTV
  CNVSHKAPLLVTDPRFDVLCARIVKYYSLKRFVEESGKGLEKWGEAHDGALFHYSSGMQAVMLALGICDRVSIYGFGKSTSAKHHYHTNQKAELHLHDYE
  AEYAFYRDLVD
Full Sequence
Protein Sequence     Length: 432     Download
MHKVTEEKDG SEIETLKPII GSFSFPHLAV VKPNFSVKSS LPMKRTVRPL FALLLLLVFA    60
AMLTSRAVLR RGILSIELEY RVRIRNPPPL QLNDTLLHHA AVEIGEEKFK QEIQNLLDGN    120
FGSHARHRTF VSWRRFIHHD RGGGTASNLP ATLRSPLFYR YWLDFRKVLH DWFRKRRFQP    180
GIMSELTRSI KLPIDSLNKV VTNDKRKYSS CAVVGNSGIL LNRDYGSEID AHEAVIRLNN    240
ARVDHFETKV GKKTSISFMN SNILHLCARR AGCFCHPYGD HVPIVMYICQ AVHFLDYTVC    300
NVSHKAPLLV TDPRFDVLCA RIVKYYSLKR FVEESGKGLE KWGEAHDGAL FHYSSGMQAV    360
MLALGICDRV SIYGFGKSTS AKHHYHTNQK AELHLHDYEA EYAFYRDLVD GHRPIPFLED    420
RFKVPPVVMY H*                                                        480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00777Glyco_transf_295.0e-935441063+
pfam00777Glyco_transf_295.0e-1818726583+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008373sialyltransferase activity
GO:0030173integral to Golgi membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAJ15149.1014301420sialyltransferase-like protein [Medicago truncatula]
EMBLCAN64919.10434311389hypothetical protein [Vitis vinifera]
RefSeqXP_002277132.10434311389PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002306228.10434311390predicted protein [Populus trichocarpa]
RefSeqXP_002523786.1014311434sialyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wnf_A0.0000000000000215940056280A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2wnb_A0.0000000000000215940056280A Chain A, Crystal Structure Of A Mammalian Sialyltransferase In Complex With Disaccharide And Cmp
PDB2wml_A0.00000000000006211400100280A Chain A, Crystal Structure Of A Mammalian Sialyltransferase
Transmembrane Domains
StartEnd
4769
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CU5391802321744050
DR9397892511824320
CN9480462192054230
CB0072132212124320
GT2436632601564110
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00099.1
Arabidopsis lyrata470889
Arabidopsis thalianaAT1G08280.1
Brachypodium distachyonBradi5g15097.1Bradi4g42490.1Bradi2g55530.1
Brassica rapaBra018639
Carica papayaevm.model.supercontig_32.97
Capsella rubellaCarubv10009362m
Citrus clementinaCiclev10028611m
Citrus sinensisorange1.1g045324m
Cucumis sativusCucsa.385070.1
Eucalyptus grandisEucgr.B03871.2Eucgr.B03871.1Eucgr.B03872.1
Fragaria vescamrna22044.1-v1.0-hybrid
Glycine maxGlyma12g09360.1Glyma12g09380.1Glyma12g09370.1Glyma11g19080.1
Gossypium raimondiiGorai.004G009500.1Gorai.009G086400.1Gorai.001G121600.1Gorai.001G121600.2
Linum usitatissimumLus10043382Lus10019538
Malus domesticaMDP0000819808MDP0000297352MDP0000232578
Manihot esculentacassava4.1_025383mcassava4.1_029496m
Medicago truncatulaMedtr4g053520.1
Mimulus guttatusmgv1a007914m
Oryza sativaLOC_Os01g63970.1LOC_Os04g42760.1LOC_Os12g05550.1
Panicum virgatumPavirv00000013mPavirv00026461mPavirv00017508mPavirv00017918mPavirv00063645m
Pavirv00039153mPavirv00003354mPavirv00055978m
Physcomitrella patensPp1s66_22V6.1Pp1s258_38V6.1Pp1s269_58V6.1
Picea abiesMA_473578g0010MA_5257g0010MA_76451g0010MA_10437278g0030MA_10426176g0010
MA_180941g0010
Populus trichocarpaPotri.009G144000.1Potri.004G184200.1
Prunus persicappa006961m
Ricinus communis30055.m001540
Setaria italicaSi010021mSi001764mSi028299mSi012629mSi027686m
Selaginella moellendorffii133452589
Sorghum bicolorSb05g003170.1Sb05g003150.1Sb06g021930.1Sb05g003160.1Sb03g040480.1
Thellungiella halophilaThhalv10007826m
Vitis viniferaGSVIVT01036150001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny