y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.011G136600.1
FamilyAA3
Protein PropertiesLength: 756 Molecular Weight: 82539.7 Isoelectric Point: 7.7701
ChromosomeChromosome/Scaffold: 11 Start: 31540637 End: 31544813
Descriptionfatty alcohol oxidase 3
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA31757430
  DNPAWKAIGYEVSDNEKQNNVSNNRPLEKGTIETMHESDSTLQQSLAKKGLNVTLDFKSNILKVKCDAVVVGSGCGGGVAAAVLSSAGHKVVVLEKGNYF
  SPQDYSSLEGPSMKQLYETGGILASADSRVLILAGSTVGGGSAVNWSACIKTPHKVLKDWSEGHKLPFFSSQEYLSAMETVCERIGVTENCTQEGFQNQV
  LRKGCQNLGLKVDYVARNSSGNHYCGSCGYGCPKGEKQGTQATWLVDAVDKGAVIITGCKAEKLLLESNRSGNGRKKKCLGVVAKVLNKVVTMKLQIEAK
  VTISSGGALLTPSLLISSGLHNKNIGRNLHLHPVLMTWGYFPESNNSEFKGKVYEGGIITSVHKVPSTDSKSDSRAIIETPSLGPACFAALFPWESGLDF
  KERMLNYPRTAHLITIIRDMACGQVTSEGRIIYKLNEIDRENMRAGMQQALRILIAAGAVEVGTHRSDGQRLRCSGVSEDKVQEFLDSVCPMEGALSPGD
  KWNLYSSAHQMGSCRMGVNEKEGAVDENGETWEAEGLFVCDASVLPTAVGVNPMITIQSTAYCISNRIV
Full Sequence
Protein Sequence     Length: 756     Download
MRREFHPLLR GGRGHSKYKH GFSAAEMESL ASMCEVVLPP LPMDAFKSRK EDQAGDDDTK    60
LLQSFCDISG SRYPIPHEVA ELLTNTSLIE ALILVRVVLW MLATRLGTLL LCGFLCLGEK    120
WPYINNFSNM SLEKREKIVQ KWLKHRFLTP IRLAFVYVKV LCLYSFFSMV DENGDNPAWK    180
AIGYEVSDNE KQNNVSNNRP LEKGTIETMH ESDSTLQQSL AKKGLNVTLD FKSNILKVKC    240
DAVVVGSGCG GGVAAAVLSS AGHKVVVLEK GNYFSPQDYS SLEGPSMKQL YETGGILASA    300
DSRVLILAGS TVGGGSAVNW SACIKTPHKV LKDWSEGHKL PFFSSQEYLS AMETVCERIG    360
VTENCTQEGF QNQVLRKGCQ NLGLKVDYVA RNSSGNHYCG SCGYGCPKGE KQGTQATWLV    420
DAVDKGAVII TGCKAEKLLL ESNRSGNGRK KKCLGVVAKV LNKVVTMKLQ IEAKVTISSG    480
GALLTPSLLI SSGLHNKNIG RNLHLHPVLM TWGYFPESNN SEFKGKVYEG GIITSVHKVP    540
STDSKSDSRA IIETPSLGPA CFAALFPWES GLDFKERMLN YPRTAHLITI IRDMACGQVT    600
SEGRIIYKLN EIDRENMRAG MQQALRILIA AGAVEVGTHR SDGQRLRCSG VSEDKVQEFL    660
DSVCPMEGAL SPGDKWNLYS SAHQMGSCRM GVNEKEGAVD ENGETWEAEG LFVCDASVLP    720
TAVGVNPMIT IQSTAYCISN RIVDYLGRGQ ISEVP*                              780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR02462pyranose_ox8.0e-5645747109+
pfam05199GMC_oxred_C2.0e-22607738132+
COG2303BetA8.0e-24263731532+
pfam00732GMC_oxred_N5.0e-85287508225+
Gene Ontology
GO TermDescription
GO:0009055electron carrier activity
GO:0016491oxidoreductase activity
GO:0016614oxidoreductase activity, acting on CH-OH group of donors
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN71289.1017461735hypothetical protein [Vitis vinifera]
EMBLCAP15762.1017511749long chain fatty alcohol oxidase FAO1 [Lotus japonicus]
RefSeqXP_002285334.1017461735PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002311685.1017461741predicted protein [Populus trichocarpa]
RefSeqXP_002314488.10277481715predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1naa_B0.0000022417474539A Chain A, Cellobiose Dehydrogenase Flavoprotein Fragment In Complex With Cellobionolactam
PDB1naa_A0.0000022417474539A Chain A, Cellobiose Dehydrogenase Flavoprotein Fragment In Complex With Cellobionolactam
PDB1kdg_B0.0000022417479544A Chain A, Crystal Structure Of The Flavin Domain Of Cellobiose Dehydrogenase
PDB1kdg_A0.0000022417479544A Chain A, Crystal Structure Of The Flavin Domain Of Cellobiose Dehydrogenase
PDB3t37_A0.000924072018498A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO79475375217470
HO7792244592106680
HO7933302453375810
ES8156643523406910
EX2751362944467390
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_089_00009.1Aquca_049_00132.1Aquca_034_00307.1Aquca_034_00304.1
Arabidopsis lyrata914728491906479855470376
Arabidopsis thalianaAT4G19380.1AT4G28570.1AT3G23410.1AT1G03990.1
Brachypodium distachyonBradi3g28677.1Bradi3g28657.1Bradi3g49085.1
Brassica rapaBra012548Bra024190Bra013391Bra015283Bra001912
Bra014947
Carica papayaevm.model.supercontig_165.33evm.model.supercontig_44.31evm.model.supercontig_2124.1
Capsella rubellaCarubv10004418mCarubv10004208mCarubv10012453mCarubv10004212mCarubv10013046m
Citrus clementinaCiclev10011111mCiclev10004403mCiclev10004405mCiclev10018992m
Citrus sinensisorange1.1g003990morange1.1g004496m
Cucumis sativusCucsa.037200.2Cucsa.037200.1Cucsa.035240.1Cucsa.255570.1
Eucalyptus grandisEucgr.H03017.2Eucgr.H03017.1Eucgr.H00753.1Eucgr.K02114.1Eucgr.D02566.1
Eucgr.D02568.1
Fragaria vescamrna08288.1-v1.0-hybridmrna11513.1-v1.0-hybridmrna08285.1-v1.0-hybrid
Glycine maxGlyma09g35210.2Glyma01g35620.1Glyma16g16415.1Glyma16g08300.2Glyma10g32640.2
Glyma12g15940.1Glyma19g34960.1Glyma06g42400.2Glyma03g32220.2
Gossypium raimondiiGorai.001G179800.3Gorai.001G179800.2Gorai.001G179800.1Gorai.011G177100.3Gorai.011G177100.2
Gorai.011G177100.1Gorai.006G252500.1
Linum usitatissimumLus10003621Lus10024922Lus10035673Lus10008239Lus10022903
Lus10037257Lus10011800
Malus domesticaMDP0000233110MDP0000173300MDP0000208936MDP0000197715
Manihot esculentacassava4.1_004067mcassava4.1_002349mcassava4.1_002619mcassava4.1_002379mcassava4.1_025870m
Medicago truncatulaMedtr5g025650.1Medtr8g072210.1Medtr4g081080.1Medtr1g075650.1Medtr4g080890.1
Mimulus guttatusmgv1a001761mmgv1a022390mmgv1a001868mmgv1a001883mmgv1a001896m
Oryza sativaLOC_Os10g33540.1LOC_Os10g33520.1LOC_Os10g33460.1LOC_Os02g40840.1
Panicum virgatumPavirv00054947m
Physcomitrella patensPp1s58_61V6.1Pp1s7_216V6.1Pp1s48_250V6.1Pp1s2_413V6.1
Phaseolus vulgarisPhvul.002G122600.1Phvul.003G278200.1Phvul.007G124200.1Phvul.001G162800.1
Picea abiesMA_10427118g0010MA_9032943g0010MA_9483g0010MA_10427421g0010MA_242814g0010
Populus trichocarpaPotri.004G234900.2Potri.004G234900.1Potri.010G069100.1Potri.008G169300.1Potri.002G259700.1
Prunus persicappa014756mppa018458mppa021498m
Ricinus communis29827.m00265529981.m00058628492.m000467
Setaria italicaSi034362mSi034354mSi034359mSi016380m
Selaginella moellendorffii1140891168557460173531
Sorghum bicolorSb01g019470.1Sb01g019460.1Sb01g019480.1Sb04g026370.1Sb04g026390.1
Thellungiella halophilaThhalv10024717mThhalv10024496mThhalv10024528mThhalv10020141mThhalv10006882m
Vitis viniferaGSVIVT01036891001GSVIVT01027855001GSVIVT01028371001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)