y
Basic Information | |
---|---|
Species | Phaseolus vulgaris |
Cazyme ID | Phvul.011G152800.1 |
Family | AA6 |
Protein Properties | Length: 180 Molecular Weight: 19383.2 Isoelectric Point: 8.0417 |
Chromosome | Chromosome/Scaffold: 11 Start: 40025614 End: 40026315 |
Description | flavodoxin-like quinone reductase 1 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 11 | 156 | 0 |
WKTNVPIISRKELLEGDGFVFGFPAKFGMMAAEFQAFLDLTASVWNEEEQLLKGKPAGIFFSTGCQGGGQETTALTAIPQLVNRGMLFVPIGNILGAEKC EMEEVRGGSPFGAGTYAGSDGSREPSEIELKQAFHQGKYIATITKK |
Full Sequence |
---|
Protein Sequence Length: 180 Download |
VPDTLAPRAS WKTNVPIISR KELLEGDGFV FGFPAKFGMM AAEFQAFLDL TASVWNEEEQ 60 LLKGKPAGIF FSTGCQGGGQ ETTALTAIPQ LVNRGMLFVP IGNILGAEKC EMEEVRGGSP 120 FGAGTYAGSD GSREPSEIEL KQAFHQGKYI ATITKKLKRD PQCSFPKIAR RLSQVVPQS* 180 240 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam02525 | Flavodoxin_2 | 0.006 | 20 | 74 | 61 | + Flavodoxin-like fold. This family consists of a domain with a flavodoxin-like fold. The family includes bacterial and eukaryotic NAD(P)H dehydrogenase (quinone) EC:1.6.99.2. These enzymes catalyze the NAD(P)H-dependent two-electron reductions of quinones and protect cells against damage by free radicals and reactive oxygen species. This enzyme uses a FAD co-factor. The equation for this reaction is:- NAD(P)H + acceptor <=> NAD(P)(+) + reduced acceptor. This enzyme is also involved in the bioactivation of prodrugs used in chemotherapy. The family also includes acyl carrier protein phosphodiesterase EC:3.1.4.14. This enzyme converts holo-ACP to apo-ACP by hydrolytic cleavage of the phosphopantetheine residue from ACP. This family is related to pfam03358 and pfam00258. | ||
pfam03358 | FMN_red | 6.0e-8 | 20 | 102 | 83 | + NADPH-dependent FMN reductase. | ||
COG0655 | WrbA | 7.0e-23 | 20 | 159 | 141 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
TIGR01755 | flav_wrbA | 1.0e-40 | 1 | 157 | 159 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
PRK03767 | PRK03767 | 2.0e-45 | 1 | 159 | 161 | + NAD(P)H:quinone oxidoreductase; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACJ86051.1 | 0 | 1 | 159 | 40 | 201 | unknown [Medicago truncatula] |
GenBank | ACU13760.1 | 0 | 1 | 159 | 36 | 197 | unknown [Glycine max] |
GenBank | ACU13985.1 | 0 | 1 | 159 | 40 | 201 | unknown [Glycine max] |
RefSeq | XP_002319258.1 | 0 | 1 | 158 | 40 | 200 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002534445.1 | 0 | 1 | 158 | 40 | 200 | Minor allergen Alt a, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3b6m_B | 1e-31 | 1 | 158 | 39 | 197 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
PDB | 3b6m_A | 1e-31 | 1 | 158 | 39 | 197 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
PDB | 3b6k_B | 1e-31 | 1 | 158 | 39 | 197 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
PDB | 3b6k_A | 1e-31 | 1 | 158 | 39 | 197 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
PDB | 3b6j_B | 1e-31 | 1 | 158 | 39 | 197 | A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
HO021244 | 163 | 12 | 171 | 0 |
FS978562 | 150 | 8 | 157 | 0 |
FS977959 | 166 | 1 | 160 | 0 |
CX533054 | 171 | 1 | 165 | 0 |
BE205413 | 171 | 1 | 165 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |