y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.011G159800.1
FamilyGT31
Protein PropertiesLength: 348 Molecular Weight: 39094.9 Isoelectric Point: 8.271
ChromosomeChromosome/Scaffold: 11 Start: 41969827 End: 41976266
DescriptionGalactosyltransferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT311032950
  RREALRKTWFPSDHQGLQRLEEATGLAFRFIIGRTSNRGKMSALHKEVAEYDDFILLDIQEEYSKLPYKTLAFFKAAYALFDADFYVKADDDIYLRPDRL
  SLLLAKERSHPQTYIGCMKKGPVFTDPKLKWYEPLSNLLGKEYFLHAYGPIYALSTDVVSSLVALRNDSFRMFSNEDVTIGAWMLAMNVNHEN
Full Sequence
Protein Sequence     Length: 348     Download
MPSSPKSYAL PYARYPSPFA TRRSTLSLLL LSALLILFLF AVVSLIAQIR HNRCINVHPR    60
SVRVVWEHAA NANANAAVGV GDGERHKVMG FVGIQTGFGS AGRREALRKT WFPSDHQGLQ    120
RLEEATGLAF RFIIGRTSNR GKMSALHKEV AEYDDFILLD IQEEYSKLPY KTLAFFKAAY    180
ALFDADFYVK ADDDIYLRPD RLSLLLAKER SHPQTYIGCM KKGPVFTDPK LKWYEPLSNL    240
LGKEYFLHAY GPIYALSTDV VSSLVALRND SFRMFSNEDV TIGAWMLAMN VNHENNHELC    300
ATDCTATSVA VWDIPKCSGL CNPEKKMLEL HQKEACFKTP TLESDDK*                 360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03133PLN031332.0e-1291304222+
PLN03193PLN031931.0e-5181333267+
pfam01762Galactosyl_T8.0e-52103297202+
Gene Ontology
GO TermDescription
GO:0006486protein glycosylation
GO:0008378galactosyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACJ84378.102134621341unknown [Medicago truncatula]
RefSeqNP_175736.205234753345galactosyltransferase family protein [Arabidopsis thaliana]
RefSeqNP_188114.1013471343galactosyltransferase family protein [Arabidopsis thaliana]
RefSeqXP_002317466.103834611326predicted protein [Populus trichocarpa]
RefSeqXP_002330737.1013461351predicted protein [Populus trichocarpa]
Transmembrane Domains
StartEnd
2547
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX525508295523460
EV538084266833480
DR935688260873460
FF5536202211273470
CO074274267533170
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_081_00004.1
Arabidopsis lyrata474455901308897766
Arabidopsis thalianaAT1G53290.1AT3G14960.1AT2G26100.1
Brachypodium distachyonBradi2g33090.1Bradi1g48880.1
Brassica rapaBra027291Bra038114Bra001576Bra034289
Carica papayaevm.model.supercontig_97.96
Capsella rubellaCarubv10023358mCarubv10009980mCarubv10009620mCarubv10014091m
Citrus clementinaCiclev10020877mCiclev10008876mCiclev10010334m
Citrus sinensisorange1.1g018669morange1.1g018637morange1.1g020201m
Cucumis sativusCucsa.122670.1Cucsa.122670.2
Eucalyptus grandisEucgr.F03260.2Eucgr.F03260.1Eucgr.F03260.5Eucgr.F01224.1Eucgr.F03260.3
Eucgr.F03260.4Eucgr.C03050.1
Fragaria vescamrna27228.1-v1.0-hybridmrna02689.1-v1.0-hybrid
Glycine maxGlyma13g34630.1Glyma06g33880.1Glyma20g09170.1
Gossypium raimondiiGorai.009G368400.1Gorai.009G368400.2Gorai.010G100900.1Gorai.002G062000.1
Linum usitatissimumLus10014451Lus10023955Lus10013683
Malus domesticaMDP0000323739MDP0000306900MDP0000237443
Manihot esculentacassava4.1_010336mcassava4.1_011023m
Mimulus guttatusmgv1a009062m
Oryza sativaLOC_Os06g06280.1LOC_Os06g06280.2LOC_Os05g11060.1LOC_Os05g11060.2
Panicum virgatumPavirv00018938mPavirv00043119mPavirv00019539mPavirv00061117mPavirv00048022m
Pavirv00036678m
Physcomitrella patensPp1s34_219V6.1Pp1s65_64V6.1
Phaseolus vulgarisPhvul.005G067100.1
Picea abiesMA_10428560g0010MA_10426473g0010
Populus trichocarpaPotri.006G228900.3Potri.006G228900.4Potri.006G228900.1Potri.006G228900.2Potri.011G111700.2
Potri.011G111700.1Potri.001G392700.1
Prunus persicappa007915mppa007437m
Ricinus communis30150.m00048629794.m003321
Setaria italicaSi022377mSi006727m
Selaginella moellendorffii5630166328
Sorghum bicolorSb09g006190.1Sb10g003920.1
Thellungiella halophilaThhalv10021058mThhalv10002018mThhalv10011624m
Vitis viniferaGSVIVT01035404001GSVIVT01014218001
Volvox carteriVocar20001878m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)