y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPhaseolus vulgaris
Cazyme IDPhvul.011G206800.1
FamilyGH2
Protein PropertiesLength: 1121 Molecular Weight: 126646 Isoelectric Point: 5.8143
ChromosomeChromosome/Scaffold: 11 Start: 48637282 End: 48646419
Descriptionglycoside hydrolase family 2 protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH2919840
  VKSLSGYWKFFIADRPSNVPTNFYETEFHDSEWKNLPVPSNWQLHGFDIPIYTNVVYPFPVDPPFIPMENPTGCYRTYFQIPKEWEGRRILLHFEAVDSA
  FCAWINGHPVGYSQDSRLPAEFEITDFCHPCGSDLKNVLAVQVYRWSDGSYLEDQDQWRLSGIHRDVLLMSKPEVFVTDYFFKSNLAEDFSYADILVEVK
  IDRLKETSKDNVLTDYSIEATLFDSGSWYTSEGIADLLSSNVADIKLQPSSTPSPTLGFHGYVLTGKLQSPKLWSAEKPYLYTLVVVLKDQSGRVVDCES
  CPVGFRKVSKAHKQLLVNGHAVVIRGVNRHEHHPQVGKANIESCMIKDLVLMKQNNINAVRNSHYPQHPRWYELCDLFGMYMIDEANIETHGFDYSKHLK
  HPTLEPMWASAMLDRVIGMVERDKNHTCIISWSLGNESGFGTNHFALAGWIRGRDSSRVLHYEGGGSRTPCTDIVCPMYMRVWDMVKIANDPTETRPLIL
  CEYSHAMGNSNGNLHTYWEAIDNTFGLQGGFIWDWVDQALVKVYEDGTKHWAYGGEFGDVPNDLNFCLNGLTFPDRTPHPVLHEVKYLYQPIKVALNEGK
  LEIKNTHFFQTTEGLESSWYISANGYNLGSGTLDLAPIKPQSSYAVDWESGPWYSLWASSSEEELFLTLTFKLLDSTRWVEAGHIVSSAQVQLPARRSIL
  PHAIDISSGTLVAETLGDTIIVKQQDVWDLTLNTKTGLVESWKVKGVHILKKGILPCFWRAPIDNDKGGEEASYLTRWKAAGMDCLHFIAESCSVQNITE
  NSVRILVVFLGVTKGAEGSLSNQDKSKVLYTTEVTYTIYASGDIIIECQVKPNPDLPPLPRVGVELNLEKSLDLVTWYGRGPFECYPDRKAAAQ
Full Sequence
Protein Sequence     Length: 1121     Download
MASSSLVVVG PLSLTQQNGY KVWEDPSFIK WRKRDPHVTL HCHDSLEGSL KYWYQRNKVD    60
FLVSQSAVWN DDAVQGSLDC AAFWVKDLPF VKSLSGYWKF FIADRPSNVP TNFYETEFHD    120
SEWKNLPVPS NWQLHGFDIP IYTNVVYPFP VDPPFIPMEN PTGCYRTYFQ IPKEWEGRRI    180
LLHFEAVDSA FCAWINGHPV GYSQDSRLPA EFEITDFCHP CGSDLKNVLA VQVYRWSDGS    240
YLEDQDQWRL SGIHRDVLLM SKPEVFVTDY FFKSNLAEDF SYADILVEVK IDRLKETSKD    300
NVLTDYSIEA TLFDSGSWYT SEGIADLLSS NVADIKLQPS STPSPTLGFH GYVLTGKLQS    360
PKLWSAEKPY LYTLVVVLKD QSGRVVDCES CPVGFRKVSK AHKQLLVNGH AVVIRGVNRH    420
EHHPQVGKAN IESCMIKDLV LMKQNNINAV RNSHYPQHPR WYELCDLFGM YMIDEANIET    480
HGFDYSKHLK HPTLEPMWAS AMLDRVIGMV ERDKNHTCII SWSLGNESGF GTNHFALAGW    540
IRGRDSSRVL HYEGGGSRTP CTDIVCPMYM RVWDMVKIAN DPTETRPLIL CEYSHAMGNS    600
NGNLHTYWEA IDNTFGLQGG FIWDWVDQAL VKVYEDGTKH WAYGGEFGDV PNDLNFCLNG    660
LTFPDRTPHP VLHEVKYLYQ PIKVALNEGK LEIKNTHFFQ TTEGLESSWY ISANGYNLGS    720
GTLDLAPIKP QSSYAVDWES GPWYSLWASS SEEELFLTLT FKLLDSTRWV EAGHIVSSAQ    780
VQLPARRSIL PHAIDISSGT LVAETLGDTI IVKQQDVWDL TLNTKTGLVE SWKVKGVHIL    840
KKGILPCFWR APIDNDKGGE EASYLTRWKA AGMDCLHFIA ESCSVQNITE NSVRILVVFL    900
GVTKGAEGSL SNQDKSKVLY TTEVTYTIYA SGDIIIECQV KPNPDLPPLP RVGVELNLEK    960
SLDLVTWYGR GPFECYPDRK AAAQVAVYEH NVGELHVPYI FPGESSGRAD VRWATFRNKN    1020
GFGIYASRYG SSPPMQMSAS YYSTSELARA THNEELIEGD SIEVHLDHKH MGLGGDDSWS    1080
PCVHNHYLIP PVSYSFSVRL CPVTPDTSGY DIYKSQFQNS *                        1140
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
smart01038Bgal_small_N2.0e-898201100282+
pfam02836Glyco_hydro_2_C4.0e-102403683291+
COG3250LacZ7.0e-15491984903+
PRK09525lacZ08911021045+
PRK10340ebgA09211031016+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002266400.108111941114PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002266434.108111941115PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002299206.101111911110predicted protein [Populus trichocarpa]
RefSeqXP_002303929.101111911113predicted protein [Populus trichocarpa]
RefSeqXP_002513059.101111911110beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1f4h_D0911101491019A Chain A, Crystal Structure Of Wild-Type E.Coli Gs In Complex With Adp And Glucose(Wtgsb)
PDB1f4h_C0911101491019A Chain A, Crystal Structure Of Wild-Type E.Coli Gs In Complex With Adp And Glucose(Wtgsb)
PDB1f4h_B0911101491019A Chain A, Crystal Structure Of Wild-Type E.Coli Gs In Complex With Adp And Glucose(Wtgsb)
PDB1f4h_A0911101491019A Chain A, Crystal Structure Of Wild-Type E.Coli Gs In Complex With Adp And Glucose(Wtgsb)
PDB1f4a_D0911101491019A Chain A, E. Coli (Lacz) Beta-Galactosidase (Ncs Constrained Monomer- Orthorhombic)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO8042743851335160
HO791335257152710
HO791335862703550
EL4443012974447400
HO804274505075550.00000000000005
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00605.1Aquca_014_00605.2
Arabidopsis lyrata485844
Arabidopsis thalianaAT3G54440.1AT3G54440.2AT3G54440.3
Brachypodium distachyonBradi2g61010.1
Brassica rapaBra014816
Carica papayaevm.model.supercontig_540.3
Capsella rubellaCarubv10019396m
Chlamydomonas reinhardtiiCre08.g379450.t1.3
Citrus clementinaCiclev10030068mCiclev10027821m
Citrus sinensisorange1.1g004315morange1.1g004363morange1.1g006933morange1.1g023943morange1.1g023667m
orange1.1g022918morange1.1g007038m
Cucumis sativusCucsa.307940.11Cucsa.307940.1Cucsa.307940.12
Eucalyptus grandisEucgr.J01181.1
Fragaria vescamrna14286.1-v1.0-hybrid
Glycine maxGlyma13g26700.1Glyma15g37670.1
Gossypium raimondiiGorai.010G216500.1
Linum usitatissimumLus10024155Lus10039520Lus10039519
Manihot esculentacassava4.1_002723m
Medicago truncatulaMedtr8g039160.1
Mimulus guttatusmgv1a000801m
Oryza sativaLOC_Os01g72340.1
Panicum virgatumPavirv00010284mPavirv00069653m
Physcomitrella patensPp1s130_43V6.1
Picea abiesMA_10429668g0010
Populus trichocarpaPotri.003G196500.1Potri.003G196500.2Potri.001G027400.1
Prunus persicappa000508mppa000532m
Ricinus communis30131.m007196
Setaria italicaSi000118mSi000119m
Selaginella moellendorffii181800
Sorghum bicolorSb03g046050.2Sb03g046050.1
Thellungiella halophilaThhalv10010080m
Vitis viniferaGSVIVT01013489001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny