Basic Information | |
---|---|
Species | Populus trichocarpa |
Cazyme ID | Potri.001G351600.1 |
Family | CBM43 |
Protein Properties | Length: 90 Molecular Weight: 9931.12 Isoelectric Point: 6.204 |
Chromosome | Chromosome/Scaffold: 01 Start: 35882326 End: 35882749 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 6 | 87 | 2.6e-31 |
WCVAKPSATDAELSANLEFACVHVDCTTIQPNGPCFNPNTFINHASVAMNLYYSFHGRNLWNCDYQKSGLITKTDPSYGTCQ |
Full Sequence |
---|
Protein Sequence Length: 90 Download |
MQDKTWCVAK PSATDAELSA NLEFACVHVD CTTIQPNGPC FNPNTFINHA SVAMNLYYSF 60 HGRNLWNCDY QKSGLITKTD PSYGTCQYA* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 3.0e-15 | 5 | 74 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 5.0e-33 | 5 | 88 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_001042566.1 | 1e-35 | 3 | 88 | 35 | 120 | Os01g0243700 [Oryza sativa (japonica cultivar-group)] |
RefSeq | XP_002300017.1 | 0 | 1 | 82 | 1 | 82 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002300444.1 | 3e-34 | 2 | 89 | 28 | 115 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002519703.1 | 1e-34 | 3 | 88 | 38 | 124 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
RefSeq | XP_002528491.1 | 1e-33 | 2 | 89 | 30 | 117 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 7e-27 | 5 | 88 | 12 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EG713516 | 86 | 3 | 88 | 6e-35 |
CI066606 | 86 | 3 | 88 | 1e-34 |
CX100474 | 86 | 3 | 88 | 1e-34 |
CI764574 | 84 | 3 | 86 | 1e-34 |
AJ774139 | 89 | 2 | 90 | 5e-34 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|