Basic Information | |
---|---|
Species | Populus trichocarpa |
Cazyme ID | Potri.001G385500.1 |
Family | CBM57 |
Protein Properties | Length: 368 Molecular Weight: 40145.8 Isoelectric Point: 8.3475 |
Chromosome | Chromosome/Scaffold: 01 Start: 40072674 End: 40074996 |
Description | Leucine-rich repeat transmembrane protein kinase |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM57 | 18 | 136 | 8.2e-26 |
SDSYTWTNATKLSANTSALYMDARLSPISLTYYGFCMGNGSYTVTLHFAEITFTDDKTHSSLGRRFFDIYIQGKRVQKDFSIQEEAGGVGKAIIKNFTAI VTGNALEIRFYWAGKGTPG |
Full Sequence |
---|
Protein Sequence Length: 368 Download |
TNWAISTTGH FMDDARSSDS YTWTNATKLS ANTSALYMDA RLSPISLTYY GFCMGNGSYT 60 VTLHFAEITF TDDKTHSSLG RRFFDIYIQG KRVQKDFSIQ EEAGGVGKAI IKNFTAIVTG 120 NALEIRFYWA GKGTPGVPVR GVYGPLISSI SVTPDFVPPS ENSRSNGTSA GNVAGIVAAV 180 VVVIFLILGI LWWKGCLGQK ISMRHDLKGL ELKTGSFTLR QIKAATNNFD PANKIGEGGF 240 GPVYKQLSSK SKQGNREFVN EIGMISALQH PHLVKLHGCC IEGNQLLLVY EYMEKNSLAC 300 ALFGPEEYQL NLEWATRHTI CVGIAKDIKA TNVLLDKNPN PKISDFGLAK LDEEENTHIS 360 TRVAGTL* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00180 | PKc | 2.0e-23 | 235 | 367 | 161 | + Catalytic domain of Protein Kinases. Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which one kinase activates a second kinase, which in turn, may act on other kinases; this sequential action transmits a signal from the cell surface to target proteins, which results in cellular responses. The PK family is one of the largest known protein families with more than 100 homologous yeast enzymes and 550 human proteins. A fraction of PK family members are pseudokinases that lack crucial residues for catalytic activity. The mutiplicity of kinases allows for specific regulation according to substrate, tissue distribution, and cellular localization. PKs regulate many cellular processes including proliferation, division, differentiation, motility, survival, metabolism, cell-cycle progression, cytoskeletal rearrangement, immunity, and neuronal functions. Many kinases are implicated in the development of various human diseases including different types of cancer. | ||
cd00192 | PTKc | 3.0e-24 | 233 | 350 | 153 | + Catalytic domain of Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain, leading to intracellular signaling. Some RTKs are orphan receptors with no known ligands. Non-receptor (or cytoplasmic) tyr kinases are distributed in different intracellular compartments and are usually multi-domain proteins containing a catalytic tyr kinase domain as well as various regulatory domains such as SH3 and SH2. PTKs are usually autoinhibited and require a mechanism for activation. In many PTKs, the phosphorylation of tyr residues in the activation loop is essential for optimal activity. Aberrant expression of PTKs is associated with many development abnormalities and cancers. | ||
smart00221 | STYKc | 6.0e-25 | 234 | 363 | 163 | + Protein kinase; unclassified specificity. Phosphotransferases. The specificity of this class of kinases can not be predicted. Possible dual-specificity Ser/Thr/Tyr kinase. | ||
smart00219 | TyrKc | 2.0e-25 | 234 | 363 | 163 | + Tyrosine kinase, catalytic domain. Phosphotransferases. Tyrosine-specific kinase subfamily. | ||
pfam11721 | Malectin | 6.0e-50 | 18 | 150 | 135 | + Di-glucose binding within endoplasmic reticulum. Malectin is a membrane-anchored protein of the endoplasmic reticulum that recognises and binds Glc2-N-glycan. It carries a signal peptide from residues 1-26, a C-terminal transmembrane helix from residues 255-274, and a highly conserved central part of approximately 190 residues followed by an acidic, glutamate-rich region. Carbohydrate-binding is mediated by the four aromatic residues, Y67, Y89, Y116, and F117 and the aspartate at D186. NMR-based ligand-screening studies has shown binding of the protein to maltose and related oligosaccharides, on the basis of which the protein has been designated "malectin", and its endogenous ligand is found to be Glc2-high-mannose N-glycan. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004672 | protein kinase activity |
GO:0005524 | ATP binding |
GO:0006468 | protein phosphorylation |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
EMBL | CBI20121.1 | 0 | 1 | 366 | 434 | 826 | unnamed protein product [Vitis vinifera] |
EMBL | CBI20136.1 | 0 | 1 | 367 | 137 | 529 | unnamed protein product [Vitis vinifera] |
RefSeq | XP_002334823.1 | 0 | 12 | 345 | 1 | 360 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002524511.1 | 0 | 1 | 367 | 410 | 802 | ATP binding protein, putative [Ricinus communis] |
RefSeq | XP_002524514.1 | 0 | 1 | 367 | 432 | 825 | ATP binding protein, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2qkw_B | 3e-27 | 219 | 367 | 31 | 205 | A Chain A, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto |
PDB | 3hgk_D | 1e-26 | 219 | 367 | 31 | 205 | E Chain E, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto |
PDB | 3hgk_C | 1e-26 | 219 | 367 | 31 | 205 | E Chain E, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto |
PDB | 3hgk_B | 1e-26 | 219 | 367 | 31 | 205 | E Chain E, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto |
PDB | 3hgk_A | 1e-26 | 219 | 367 | 31 | 205 | E Chain E, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto |