CAZyme Information

Basic Information
SpeciesPopulus trichocarpa
Cazyme IDPotri.002G100900.1
FamilyGH13
Protein PropertiesLength: 820 Molecular Weight: 92385.9 Isoelectric Point: 6.65
ChromosomeChromosome/Scaffold: 02 Start: 7293082 End: 7303187
Descriptionisoamylase 3
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132996600
  IKIPHLLELGVNAVELLPVFEFDEFEFQRRPNPRDHMINTWGYSTINFFAPMNRYASRGGGPRNASREFKEMVKALHGAGIEVILDVVFNHTNEADDKNP
  FTTSFRGIDNKVYYMVDLSNNGQLLNFSGCVSCFCPGNTLNCNHPVVMELILDSLRHWVIEYHVDGFRFDLASVLCRGTDGSPLDAPPIIRAIAKDSILS
  RCKIIAEPWDCGGLYLVGNFPNWDRWAEWNGKYRDDIRKFIKGDSGMKGSFATRVAGSADLYRANKRKPCHSVNFVIAHDGFTLRDLVSYNFKHNDANGE
  GGNDGCNDNFSWNCGFEGETDDHNIKALRFRQMKNFHLALMISQGTPMMLMGDEYGHTRYGN
Full Sequence
Protein Sequence     Length: 820     Download
MLHQSLPLLC DSKIADSILL SVSHFSNNNN NNSIGSSRVL DVGLKFSKQS SGGGSSGRGF    60
SSKAGAKTTT TPNVYGRRAQ ESVLEQEEAP QKLGFKTFPG QAFPFGVSQV ENGINFAIFS    120
QHATAVTLCL SLPHRGKSER TDGGMIEVAL DPKVNKTGDI WHICIEDLPR DDVLYGYRID    180
GPRDWRQGHR FDSSIMLIDP YAKLVESRRF FGDASRKLSK FYGTYDFDSL PFDWGDDYKP    240
PNIPEKDLVI YEMNVRAFTV DKSSGLDPSI RGSYLGVIEK WYLIACTYLV LLTISFHSIK    300
IPHLLELGVN AVELLPVFEF DEFEFQRRPN PRDHMINTWG YSTINFFAPM NRYASRGGGP    360
RNASREFKEM VKALHGAGIE VILDVVFNHT NEADDKNPFT TSFRGIDNKV YYMVDLSNNG    420
QLLNFSGCVS CFCPGNTLNC NHPVVMELIL DSLRHWVIEY HVDGFRFDLA SVLCRGTDGS    480
PLDAPPIIRA IAKDSILSRC KIIAEPWDCG GLYLVGNFPN WDRWAEWNGK YRDDIRKFIK    540
GDSGMKGSFA TRVAGSADLY RANKRKPCHS VNFVIAHDGF TLRDLVSYNF KHNDANGEGG    600
NDGCNDNFSW NCGFEGETDD HNIKALRFRQ MKNFHLALMI SQGTPMMLMG DEYGHTRYGN    660
NNSYGHDTSI NNFQWGLLQS SKCLSENPLL RQLDAEKSSH FRFFSEVIKF RQTHGVFTHD    720
NFLSENDVTW HENNWENHES KFLAFTLHDQ NGGDIYLAFN AHDYIVKVSI PPPPPKRRWL    780
RVVDTNFESP DDFVPQGLPG IGSTYNVAPH SSILLEAKN* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK14510PRK145104.0e-13099724639+
PRK03705PRK037051.0e-15499730655+
cd11326AmyAc_Glg_debranch0232714484+
COG1523PulA099803738+
TIGR02100glgX_debranch099790733+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF52943.1018181782isoamylase-type starch-debranching enzyme 3 [Phaseolus vulgaris]
EMBLCBI19205.1018181774unnamed protein product [Vitis vinifera]
RefSeqXP_002284042.10181813786PREDICTED: similar to isoamylase-type starch-debranching enzyme 3 [Vitis vinifera]
RefSeqXP_002301076.1018191819predicted protein [Populus trichocarpa]
RefSeqXP_002513977.1018181781isoamylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B09972414601L Chain L, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm
PDB2vuy_A09972414601L Chain L, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm
PDB2vr5_B09972414601L Chain L, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm
PDB2vr5_A09972414601L Chain L, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm
PDB2vnc_B09972414601A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IIRXN-12280EC-3.2.1.68isoamylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7987254811936730
HO4308582815408180
HO4308581733725440
HO4308581492273750
HO798725357037370.0009
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.012G008800.1Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.2Potri.002G100900.4Potri.002G100900.3Potri.006G070800.3Potri.006G070800.2
Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2Potri.018G132500.1
Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)