CAZyme Information

Basic Information
SpeciesPopulus trichocarpa
Cazyme IDPotri.002G100900.2
FamilyGH13
Protein PropertiesLength: 779 Molecular Weight: 87684.3 Isoelectric Point: 6.51
ChromosomeChromosome/Scaffold: 02 Start: 7293082 End: 7303198
Descriptionisoamylase 3
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH132706340
  IRGSYLGVIEKIPHLLELGVNAVELLPVFEFDEFEFQRRPNPRDHMINTWGYSTINFFAPMNRYASRGGGPRNASREFKEMVKALHGAGIEVILDVVFNH
  TNEADDKNPFTTSFRGIDNKVYYMVDLSNNGQLLNFSGCGNTLNCNHPVVMELILDSLRHWVIEYHVDGFRFDLASVLCRGTDGSPLDAPPIIRAIAKDS
  ILSRCKIIAEPWDCGGLYLVGNFPNWDRWAEWNGKYRDDIRKFIKGDSGMKGSFATRVAGSADLYRANKRKPCHSVNFVIAHDGFTLRDLVSYNFKHNDA
  NGEGGNDGCNDNFSWNCGFEGETDDHNIKALRFRQMKNFHLALMISQGTPMMLMGDEYGHTRYGN
Full Sequence
Protein Sequence     Length: 779     Download
MLHQSLPLLC DSKIADSILL SVSHFSNNNN NNSIGSSRVL DVGLKFSKQS SGGGSSGRGF    60
SSKAGAKTTT TPNVYGRRAQ ESVLEQEEAP QKLGFKTFPG QAFPFGVSQV ENGINFAIFS    120
QHATAVTLCL SLPHRGKSER TDGGMIEVAL DPKVNKTGDI WHICIEDLPR DDVLYGYRID    180
GPRDWRQGHR FDSSIMLIDP YAKLVESRRF FGDASRKLSK FYGTYDFDSL PFDWGDDYKP    240
PNIPEKDLVI YEMNVRAFTV DKSSGLDPSI RGSYLGVIEK IPHLLELGVN AVELLPVFEF    300
DEFEFQRRPN PRDHMINTWG YSTINFFAPM NRYASRGGGP RNASREFKEM VKALHGAGIE    360
VILDVVFNHT NEADDKNPFT TSFRGIDNKV YYMVDLSNNG QLLNFSGCGN TLNCNHPVVM    420
ELILDSLRHW VIEYHVDGFR FDLASVLCRG TDGSPLDAPP IIRAIAKDSI LSRCKIIAEP    480
WDCGGLYLVG NFPNWDRWAE WNGKYRDDIR KFIKGDSGMK GSFATRVAGS ADLYRANKRK    540
PCHSVNFVIA HDGFTLRDLV SYNFKHNDAN GEGGNDGCND NFSWNCGFEG ETDDHNIKAL    600
RFRQMKNFHL ALMISQGTPM MLMGDEYGHT RYGNNNSYGH DTSINNFQWG LLDAEKSSHF    660
RFFSEVIKFR QTHGVFTHDN FLSENDVTWH ENNWENHESK FLAFTLHDQN GGDIYLAFNA    720
HDYIVKVSIP PPPPKRRWLR VVDTNFESPD DFVPQGLPGI GSTYNVAPHS SILLEAKN*     780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK14510PRK145104.0e-13799683599+
PRK03705PRK037057.0e-16199689614+
cd11326AmyAc_Glg_debranch0232673445+
COG1523PulA099762699+
TIGR02100glgX_debranch099749694+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAF52943.1017771782isoamylase-type starch-debranching enzyme 3 [Phaseolus vulgaris]
EMBLCBI19205.1017771774unnamed protein product [Vitis vinifera]
RefSeqXP_002284042.10177713786PREDICTED: similar to isoamylase-type starch-debranching enzyme 3 [Vitis vinifera]
RefSeqXP_002301076.1017781819predicted protein [Populus trichocarpa]
RefSeqXP_002513977.1017771781isoamylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vuy_B09968314601A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
PDB2vuy_A09968314601A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
PDB2vr5_B09968314601A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
PDB2vr5_A09968314601A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
PDB2vnc_B09968314601A Chain A, Crystal Structure Of Glycogen Debranching Enzyme Trex From Sulfolobus Solfataricus
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IIRXN-12280EC-3.2.1.68isoamylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7987254551936470
HO4308582665147770
HO4308581673525180
HO4308581292273550
HO798725356626960.0008
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00091.4Aquca_014_00091.1Aquca_014_00091.3Aquca_014_00091.2Aquca_014_00091.5
Aquca_014_00091.6Aquca_014_00091.7Aquca_018_00158.1Aquca_018_00158.2Aquca_014_00091.8
Aquca_026_00010.1
Arabidopsis lyrata911044483030470308
Arabidopsis thalianaAT4G09020.1AT2G39930.1AT1G03310.2AT1G03310.1
Brachypodium distachyonBradi4g32707.2Bradi4g32707.1Bradi3g40410.2Bradi3g40410.1Bradi2g26170.1
Brassica rapaBra000667Bra005001Bra030528Bra033388
Carica papayaevm.model.supercontig_36.185evm.model.supercontig_485.4evm.model.supercontig_115.45
Capsella rubellaCarubv10003443mCarubv10024947mCarubv10012076m
Chlamydomonas reinhardtiig4436.t1g3160.t1
Citrus clementinaCiclev10000452mCiclev10000347mCiclev10007489mCiclev10023436m
Citrus sinensisorange1.1g009902morange1.1g006791morange1.1g003977morange1.1g011993morange1.1g005976m
orange1.1g003653morange1.1g003901morange1.1g005552morange1.1g047308m
Cucumis sativusCucsa.311690.1Cucsa.281840.2Cucsa.281840.1Cucsa.084930.1
Eucalyptus grandisEucgr.B00043.1Eucgr.C02189.3Eucgr.C02189.2Eucgr.C02189.1Eucgr.K03392.1
Fragaria vescamrna11912.1-v1.0-hybridmrna12022.1-v1.0-hybridmrna27855.1-v1.0-hybrid
Glycine maxGlyma06g10540.2Glyma04g10693.3Glyma04g10693.2Glyma04g10693.1Glyma08g03210.2
Glyma08g03210.1Glyma03g30771.1Glyma19g33620.2
Gossypium raimondiiGorai.009G233800.1Gorai.009G233800.2Gorai.009G233800.3Gorai.012G008800.3Gorai.012G008800.2
Gorai.012G008800.1Gorai.007G134600.3Gorai.007G134600.2Gorai.007G134600.1
Linum usitatissimumLus10036474Lus10021586Lus10000661Lus10027999Lus10017150
Malus domesticaMDP0000119748MDP0000118987MDP0000313388MDP0000185233MDP0000647541
MDP0000258604MDP0000238431
Manihot esculentacassava4.1_001932mcassava4.1_001414m
Medicago truncatulaMedtr3g099500.1Medtr8g101490.1
Mimulus guttatusmgv1a002417mmgv1a001549mmgv1a001869m
Oryza sativaLOC_Os08g40930.1LOC_Os09g29404.3LOC_Os09g29404.1LOC_Os05g32710.1
Panicum virgatumPavirv00034683mPavirv00034682mPavirv00063957mPavirv00032505mPavirv00012813m
Physcomitrella patensPp1s25_63V6.1Pp1s36_254V6.2Pp1s36_254V6.1Pp1s62_201V6.2
Phaseolus vulgarisPhvul.009G033200.1Phvul.002G303600.1Phvul.001G148700.1Phvul.005G040300.1
Picea abiesMA_10431226g0020MA_159157g0180
Populus trichocarpaPotri.002G100900.4Potri.002G100900.3Potri.002G100900.1Potri.006G070800.3Potri.006G070800.2
Potri.006G070800.1Potri.018G132500.4Potri.018G132500.3Potri.018G132500.2Potri.018G132500.1
Potri.018G132500.5Potri.002G215400.1Potri.002G219900.1
Prunus persicappa001639mppa025097mppa001199m
Ricinus communis29908.m00608929776.m00048828153.m00028728323.m00004135877.m000015
27724.m00001829104.m000024
Setaria italicaSi029005mSi013277m
Selaginella moellendorffii10621875877414611
Sorghum bicolorSb02g027280.3Sb02g027280.2Sb02g027280.1Sb07g027200.1Sb09g019480.1
Thellungiella halophilaThhalv10028487mThhalv10028455mThhalv10028452mThhalv10016275mThhalv10006762m
Vitis viniferaGSVIVT01009087001GSVIVT01035168001GSVIVT01011096001
Volvox carteriVocar20007238mVocar20007651m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)