Basic Information | |
---|---|
Species | Populus trichocarpa |
Cazyme ID | Potri.004G182100.2 |
Family | GH19 |
Protein Properties | Length: 183 Molecular Weight: 20046.5 Isoelectric Point: 4.5155 |
Chromosome | Chromosome/Scaffold: 04 Start: 19864725 End: 19866353 |
Description | basic chitinase |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GH19 | 66 | 182 | 4.7e-37 |
FFTESMFEQMLPNRNNDSCPGKGFYTYNAYFVATEFYPGFGMTGDDDTRKRELAAFFAQTSQETSGRSIIGEDAPFTWGYCLVNELNPNSDYCDPKTKSS YPCVADYYGRGPLQLRW |
Full Sequence |
---|
Protein Sequence Length: 183 Download |
MRFWALTVLS LLLSLLLGVS SDTPQCGSKA GNATCPNDLC CSSGGYCGLT VAYCCAGCVS 60 QCRNCFFTES MFEQMLPNRN NDSCPGKGFY TYNAYFVATE FYPGFGMTGD DDTRKRELAA 120 FFAQTSQETS GRSIIGEDAP FTWGYCLVNE LNPNSDYCDP KTKSSYPCVA DYYGRGPLQL 180 RW* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
smart00270 | ChtBD1 | 5.0e-9 | 25 | 62 | 38 | + Chitin binding domain. |
cd00035 | ChtBD1 | 2.0e-9 | 25 | 63 | 39 | + Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements. |
pfam00187 | Chitin_bind_1 | 2.0e-11 | 25 | 62 | 38 | + Chitin recognition protein. |
cd00325 | chitinase_glyco_hydro_19 | 8.0e-50 | 67 | 182 | 118 | + Glycoside hydrolase family 19 chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases but they are smaller in size due to certain deletions. Despite any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the procaryotic/eucaryotic divergence. |
pfam00182 | Glyco_hydro_19 | 6.0e-60 | 66 | 182 | 117 | + Chitinase class I. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004568 | chitinase activity |
GO:0006032 | chitin catabolic process |
GO:0008061 | chitin binding |
GO:0016998 | cell wall macromolecule catabolic process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAC16010.1 | 0 | 1 | 182 | 1 | 204 | acidic chitinase [Elaeagnus umbellata] |
GenBank | AAP35269.1 | 0 | 3 | 182 | 4 | 193 | hevein-like antimicrobial peptide [Euonymus europaeus] |
GenBank | AAP35270.1 | 0 | 3 | 182 | 4 | 193 | hevein-like antimicrobial peptide [Euonymus europaeus] |
Swiss-Prot | P16061 | 0 | 1 | 182 | 1 | 182 | CHI8_POPTR RecName: Full=Endochitinase WIN8; Flags: Precursor |
RefSeq | XP_002306221.1 | 0 | 1 | 182 | 1 | 182 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 3iwr_B | 3.00004e-41 | 25 | 180 | 3 | 175 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 3iwr_A | 3.00004e-41 | 25 | 180 | 3 | 175 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 2dkv_A | 3.00004e-41 | 25 | 180 | 3 | 175 | A Chain A, Crystal Structure Of Class I Chitinase From Oryza Sativa L. Japonica |
PDB | 3cql_B | 2e-38 | 66 | 182 | 5 | 121 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
PDB | 3cql_A | 2e-38 | 66 | 182 | 5 | 121 | A Chain A, Crystal Structure Of Gh Family 19 Chitinase From Carica Papaya |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
chitin degradation II | 3.2.1.14-RXN | EC-3.2.1.14 | chitinase |
chitin degradation II | RXN-12623 | EC-3.2.1.14 | chitinase |
chitin degradation II | RXN-12624 | EC-3.2.1.14 | chitinase |
chitin degradation III (carnivorous plants) | 3.2.1.14-RXN | EC-3.2.1.14 | chitinase |