CAZyme Information

Basic Information
SpeciesPopulus trichocarpa
Cazyme IDPotri.005G036100.1
FamilyGT1
Protein PropertiesLength: 493 Molecular Weight: 54641.8 Isoelectric Point: 5.2244
ChromosomeChromosome/Scaffold: 05 Start: 2651109 End: 2652587
DescriptionUDP-glucosyl transferase 73B5
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12924592.1e-27
  VIYVAFGSQSYMTDLQMEEIALGLEMAGQPFIWVVRSRTWVPPVGWEDRVKERGLAIRDWVDQRGILEHPAIGGFLTHCGWNSVLEGLSMGVPLLAWPMG
  AEQGLNARYTEMGLKAGLMVLQERDAKDDPMTVQHNVICDSVKELIRGDQGKKARERAQELGRKARQA
Full Sequence
Protein Sequence     Length: 493     Download
MGSTSTSSPP HVVIFPFMAQ GHTLPLLDLS KALASRGTRV TIITTPANAP FILSKNSTHP    60
TISLSIIPFP KVEELPEGCE NVNHLPSPDL FVPFINATKL LQQPFEDVLK ELCDCDSTIP    120
IGVISDMFLP WTVDSCCLFD IPRIVFSGMG VLPTVIERNV SLHVPCISSL LHSEPINLPS    180
VPFPLNKTDF PDFVWRGDEK HPMLPIISEI EQAEHNSWGY VVNSFEELEG DHVAAFENHK    240
ETKAWLVGPL LLHDQSKQDL MNSGSKDVDQ KQFSPYIKWL DQKMEGVGPG NVIYVAFGSQ    300
SYMTDLQMEE IALGLEMAGQ PFIWVVRSRT WVPPVGWEDR VKERGLAIRD WVDQRGILEH    360
PAIGGFLTHC GWNSVLEGLS MGVPLLAWPM GAEQGLNARY TEMGLKAGLM VLQERDAKDD    420
PMTVQHNVIC DSVKELIRGD QGKKARERAQ ELGRKARQAV EKGGSSDKKL DELIECLTLK    480
TRIQGRPADT KG* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02670PLN026706.0e-4611452473+
PLN02448PLN024482.0e-591475509+
PLN02863PLN028638.0e-1021475492+
PLN02534PLN025343.0e-1045475494+
PLN03007PLN030071.0e-11611480492+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN66825.1064783442hypothetical protein [Vitis vinifera]
RefSeqXP_002273765.1064823475PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002273858.1064783471PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002324945.1084775467predicted protein [Populus trichocarpa]
RefSeqXP_002328555.1014921492predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A0104809480A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A074704460A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A074704460A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A074704460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acw_B2e-3914781462A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FP063067238112440
HO778430429624770
HO7786273621234740
HO778627104111120
FQ35947222692320
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_025_00292.1Aquca_025_00293.1Aquca_002_00206.1Aquca_004_00007.1Aquca_004_00008.1
Aquca_004_00009.1Aquca_031_00060.1
Arabidopsis lyrata480568874994350625471154
Arabidopsis thalianaAT2G16890.2AT5G14860.1AT1G10400.1
Brachypodium distachyonBradi2g36325.1Bradi2g36297.1Bradi4g28210.1Bradi1g43760.1Bradi1g37120.1
Bradi2g08147.1
Brassica rapaBra006271Bra008734Bra013043Bra018440
Capsella rubellaCarubv10013583mCarubv10003019mCarubv10013609mCarubv10016193mCarubv10012329m
Carubv10016195m
Citrus clementinaCiclev10015105m
Citrus sinensisorange1.1g019791morange1.1g048238m
Cucumis sativusCucsa.158560.1Cucsa.158600.1
Eucalyptus grandisEucgr.A01139.1Eucgr.J03156.1Eucgr.J03158.1Eucgr.J03155.1Eucgr.J03157.1
Eucgr.J03154.1
Fragaria vescamrna08733.1-v1.0-hybridmrna28389.1-v1.0-hybrid
Glycine maxGlyma16g08060.1
Gossypium raimondiiGorai.001G265200.1
Linum usitatissimumLus10022222Lus10022220Lus10022221Lus10026927Lus10026926
Lus10020124
Malus domesticaMDP0000575823MDP0000576836MDP0000159916MDP0000261158MDP0000296033
MDP0000800689MDP0000942526MDP0000691324MDP0000130487MDP0000203647
MDP0000865084
Manihot esculentacassava4.1_022533mcassava4.1_025192mcassava4.1_007045m
Mimulus guttatusmgv1a005626mmgv1a026899m
Oryza sativaLOC_Os06g39070.1LOC_Os09g16090.1LOC_Os09g16030.1LOC_Os09g21160.1LOC_Os04g24110.1
LOC_Os06g16000.1LOC_Os05g42040.1LOC_Os06g39080.1LOC_Os06g08830.1
Panicum virgatumPavirv00038352mPavirv00070294mPavirv00062203mPavirv00046074mPavirv00058520m
Pavirv00020575mPavirv00042658mPavirv00025139mPavirv00067592mPavirv00016340m
Pavirv00034420mPavirv00017568mPavirv00037090m
Physcomitrella patensPp1s15_417V6.2Pp1s15_417V6.1
Phaseolus vulgarisPhvul.007G048100.1Phvul.008G151900.1
Populus trichocarpaPotri.018G009000.1Potri.001G348100.1Potri.006G272600.1Potri.006G272500.2Potri.006G272500.1
Potri.018G008900.1
Prunus persicappa005107mppa023458mppa017646m
Ricinus communis29822.m00335529822.m003356
Setaria italicaSi033411mSi033010mSi006359mSi020900mSi006267m
Si006185m
Sorghum bicolorSb10g005950.1Sb02g022230.1Sb02g023640.1Sb02g023632.1Sb10g009810.1
Sb10g022980.1
Thellungiella halophilaThhalv10022679mThhalv10015356m
Vitis viniferaGSVIVT01016138001
Zea maysAC234524.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)