| Basic Information | |
|---|---|
| Species | Populus trichocarpa |
| Cazyme ID | Potri.006G023000.1 |
| Family | GT1 |
| Protein Properties | Length: 164 Molecular Weight: 18074.5 Isoelectric Point: 4.6483 |
| Chromosome | Chromosome/Scaffold: 06 Start: 1605702 End: 1606428 |
| Description | UDP-Glycosyltransferase superfamily protein |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT1 | 2 | 145 | 6.5e-34 |
| GLAKSGHPFLWIIRPDMVTGDSAILPPEFTDETKDRGFISSWCPQEEVLNHPSIGGFLTHSGWNSTAESISSGVPMLCLPFFGDQQTNCRYTCNEWGVGM EIDSNAERDKVEKLVRELMEGEKGREVKKKVMEWRKLAEEAAGP | |||
| Full Sequence |
|---|
| Protein Sequence Length: 164 Download |
| MGLAKSGHPF LWIIRPDMVT GDSAILPPEF TDETKDRGFI SSWCPQEEVL NHPSIGGFLT 60 HSGWNSTAES ISSGVPMLCL PFFGDQQTNC RYTCNEWGVG MEIDSNAERD KVEKLVRELM 120 EGEKGREVKK KVMEWRKLAE EAAGPSGSSS MNLDELVKAV LLP* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02448 | PLN02448 | 7.0e-27 | 2 | 119 | 124 | + UDP-glycosyltransferase family protein | ||
| PLN00164 | PLN00164 | 5.0e-27 | 2 | 119 | 133 | + glucosyltransferase; Provisional | ||
| PLN02992 | PLN02992 | 4.0e-27 | 2 | 119 | 138 | + coniferyl-alcohol glucosyltransferase | ||
| PLN02555 | PLN02555 | 2.0e-33 | 2 | 160 | 167 | + limonoid glucosyltransferase | ||
| PLN02410 | PLN02410 | 4.0e-38 | 1 | 119 | 121 | + UDP-glucoronosyl/UDP-glucosyl transferase family protein | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008152 | metabolic process |
| GO:0016758 | transferase activity, transferring hexosyl groups |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | XP_002308828.1 | 0 | 1 | 163 | 318 | 480 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002308829.1 | 0 | 1 | 163 | 318 | 480 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002308830.1 | 0 | 1 | 163 | 318 | 480 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002308831.1 | 0 | 1 | 163 | 318 | 480 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002323187.1 | 0 | 1 | 162 | 319 | 480 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2pq6_A | 0 | 2 | 162 | 319 | 479 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2vg8_A | 1e-29 | 1 | 153 | 291 | 460 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2vch_A | 1e-29 | 1 | 153 | 291 | 460 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
| PDB | 2vce_A | 1e-29 | 1 | 153 | 291 | 460 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| PDB | 3hbj_A | 3e-29 | 3 | 160 | 298 | 452 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| cytokinins-O-glucoside biosynthesis | RXN-4723 | EC-2.4.1.203 | trans-zeatin O-β-D-glucosyltransferase |
| cytokinins-O-glucoside biosynthesis | RXN-4726 | EC-2.4.1 | UDP-glucose:dihydrozeatin O-β-D-glucosyltransferase |
| cytokinins-O-glucoside biosynthesis | RXN-4735 | EC-2.4.1.215 | cis-zeatin O-β-D-glucosyltransferase |
| cytokinins-O-glucoside biosynthesis | RXN-4737 | EC-2.4.1 | dihydrozeatin-9-N-glucoside O-β-D-glucosyltransferase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DN490532 | 162 | 1 | 162 | 0 |
| DN500518 | 162 | 1 | 162 | 0 |
| DT513643 | 160 | 1 | 160 | 0 |
| DT504436 | 161 | 1 | 161 | 0 |
| CV280804 | 161 | 1 | 161 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
