Basic Information | |
---|---|
Species | Populus trichocarpa |
Cazyme ID | Potri.006G023000.1 |
Family | GT1 |
Protein Properties | Length: 164 Molecular Weight: 18074.5 Isoelectric Point: 4.6483 |
Chromosome | Chromosome/Scaffold: 06 Start: 1605702 End: 1606428 |
Description | UDP-Glycosyltransferase superfamily protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 2 | 145 | 6.5e-34 |
GLAKSGHPFLWIIRPDMVTGDSAILPPEFTDETKDRGFISSWCPQEEVLNHPSIGGFLTHSGWNSTAESISSGVPMLCLPFFGDQQTNCRYTCNEWGVGM EIDSNAERDKVEKLVRELMEGEKGREVKKKVMEWRKLAEEAAGP |
Full Sequence |
---|
Protein Sequence Length: 164 Download |
MGLAKSGHPF LWIIRPDMVT GDSAILPPEF TDETKDRGFI SSWCPQEEVL NHPSIGGFLT 60 HSGWNSTAES ISSGVPMLCL PFFGDQQTNC RYTCNEWGVG MEIDSNAERD KVEKLVRELM 120 EGEKGREVKK KVMEWRKLAE EAAGPSGSSS MNLDELVKAV LLP* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02448 | PLN02448 | 7.0e-27 | 2 | 119 | 124 | + UDP-glycosyltransferase family protein | ||
PLN00164 | PLN00164 | 5.0e-27 | 2 | 119 | 133 | + glucosyltransferase; Provisional | ||
PLN02992 | PLN02992 | 4.0e-27 | 2 | 119 | 138 | + coniferyl-alcohol glucosyltransferase | ||
PLN02555 | PLN02555 | 2.0e-33 | 2 | 160 | 167 | + limonoid glucosyltransferase | ||
PLN02410 | PLN02410 | 4.0e-38 | 1 | 119 | 121 | + UDP-glucoronosyl/UDP-glucosyl transferase family protein |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016758 | transferase activity, transferring hexosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | XP_002308828.1 | 0 | 1 | 163 | 318 | 480 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002308829.1 | 0 | 1 | 163 | 318 | 480 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002308830.1 | 0 | 1 | 163 | 318 | 480 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002308831.1 | 0 | 1 | 163 | 318 | 480 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002323187.1 | 0 | 1 | 162 | 319 | 480 | predicted protein [Populus trichocarpa] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2pq6_A | 0 | 2 | 162 | 319 | 479 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vg8_A | 1e-29 | 1 | 153 | 291 | 460 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vch_A | 1e-29 | 1 | 153 | 291 | 460 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase |
PDB | 2vce_A | 1e-29 | 1 | 153 | 291 | 460 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 3hbj_A | 3e-29 | 3 | 160 | 298 | 452 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
cytokinins-O-glucoside biosynthesis | RXN-4723 | EC-2.4.1.203 | trans-zeatin O-β-D-glucosyltransferase |
cytokinins-O-glucoside biosynthesis | RXN-4726 | EC-2.4.1 | UDP-glucose:dihydrozeatin O-β-D-glucosyltransferase |
cytokinins-O-glucoside biosynthesis | RXN-4735 | EC-2.4.1.215 | cis-zeatin O-β-D-glucosyltransferase |
cytokinins-O-glucoside biosynthesis | RXN-4737 | EC-2.4.1 | dihydrozeatin-9-N-glucoside O-β-D-glucosyltransferase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DN490532 | 162 | 1 | 162 | 0 |
DN500518 | 162 | 1 | 162 | 0 |
DT513643 | 160 | 1 | 160 | 0 |
DT504436 | 161 | 1 | 161 | 0 |
CV280804 | 161 | 1 | 161 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|