y PlantCAZyme

CAZyme Information

Basic Information
SpeciesPopulus trichocarpa
Cazyme IDPotri.006G266500.1
FamilyGT28
Protein PropertiesLength: 538 Molecular Weight: 58770.6 Isoelectric Point: 8.7153
ChromosomeChromosome/Scaffold: 06 Start: 26847310 End: 26851842
Descriptionmonogalactosyl diacylglycerol synthase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT283545124.4e-31
  VLLMGGGEGMGPIEATARALGDSLYDENLEEPIGQVLVICGRNKKLTNRLLSIDWKVPVQVKGFVTKMEECMGACDCIITKAGPGTIAEAMIRGLPIILN
  DYIAGQEVGNVPYVVENGCGKFSKSPKEIAKIVAEWFGPKADELSAMSQNALKLARPDA
Full Sequence
Protein Sequence     Length: 538     Download
MHNPSAVATN QEPGLAFDFL SQLGGFAFNK AVQSINSNGF SLSKSNFLFF DSPIGQKTRK    60
VNASLSLSSR SGFKSVWSEF NRAIRFHCER IPIGFASVQV GSGDNNGNDN ISSDNGNGIN    120
GLRDDGCGVL VDDGVPLNGV EGVSPKRVLI LMSDTGGGHR ASAEAIKAAF NEEFGDDYQV    180
FVTDLWSEHT PWPFNQLPKS YNFLVKHGAL WKMTYYGSAP RVIHQSNFAA TSTFIAREVA    240
KGLMKYQPDI IISVHPLMQH VPLRVLRAKG LLQKIIFTTV VTDLSTCHPT WFHKLVTRCY    300
CPSTDVSKRA MKAGLKPSQI KVYGLPVRPS FVKPVRPKGE LRRQLGMDED LPAVLLMGGG    360
EGMGPIEATA RALGDSLYDE NLEEPIGQVL VICGRNKKLT NRLLSIDWKV PVQVKGFVTK    420
MEECMGACDC IITKAGPGTI AEAMIRGLPI ILNDYIAGQE VGNVPYVVEN GCGKFSKSPK    480
EIAKIVAEWF GPKADELSAM SQNALKLARP DAVFKIVHDL HELVRHRNFV PQFSCAT*      540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0707MurG4.0e-27147517381+
PRK13608PRK136082.0e-33146526391+
PRK13609PRK136097.0e-43146523387+
pfam06925MGDG_synth3.0e-75159327169+
PLN02605PLN026050148527382+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0009058biosynthetic process
GO:0009247glycolipid biosynthetic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030246carbohydrate binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN84152.10105372520hypothetical protein [Vitis vinifera]
RefSeqXP_002283410.10853732552PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002309689.1015371537predicted protein [Populus trichocarpa]
RefSeqXP_002324925.1015371537predicted protein [Populus trichocarpa]
RefSeqXP_002515397.10153615341,2-diacylglycerol 3-beta-galactosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2u_A0.001410525235356A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
Metabolic Pathways
Pathway NameReactionECProtein Name
glycolipid biosynthesis2.4.1.46-RXNEC-2.4.1.46monogalactosyldiacylglycerol synthase
traumatin and (Z)-3-hexen-1-yl acetate biosynthesisHYDROHEX-RXN-13(S)-hydroperoxyoctadeca-9,11-dienoate lyase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2679733421755160
EX2601723001714700
GT0492283361915260
CV5305402961424370
HO4664773861405250
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00340.4Aquca_016_00340.1Aquca_048_00001.3Aquca_048_00001.1Aquca_016_00340.2
Arabidopsis lyrata899522913288488950
Arabidopsis thalianaAT2G11810.1AT4G31780.2AT5G20410.1AT4G31780.1
Brachypodium distachyonBradi4g30600.1Bradi3g54387.1Bradi3g20020.1
Brassica rapaBra023984Bra011297Bra037199Bra020104
Carica papayaevm.model.supercontig_148.42evm.model.supercontig_277.14
Capsella rubellaCarubv10006327mCarubv10013637mCarubv10000862m
Chlamydomonas reinhardtiig14367.t1
Citrus clementinaCiclev10007936mCiclev10007956mCiclev10008213mCiclev10008083m
Citrus sinensisorange1.1g036427morange1.1g012492m
Cucumis sativusCucsa.162930.1Cucsa.132470.1
Eucalyptus grandisEucgr.C04035.1Eucgr.C00320.1Eucgr.C00495.1Eucgr.C04379.1Eucgr.C04035.2
Fragaria vescamrna14993.1-v1.0-hybridmrna31719.1-v1.0-hybridmrna30765.1-v1.0-hybrid
Glycine maxGlyma17g33780.1Glyma14g12120.1Glyma13g23150.1Glyma17g11720.1
Gossypium raimondiiGorai.010G119700.2Gorai.001G039100.1Gorai.010G119700.1Gorai.013G236200.1Gorai.009G014700.1
Gorai.009G014700.3
Linum usitatissimumLus10026895Lus10003418Lus10016359Lus10008048
Malus domesticaMDP0000135680MDP0000244574MDP0000214451MDP0000829982MDP0000305295
Manihot esculentacassava4.1_005396mcassava4.1_005397mcassava4.1_006812m
Medicago truncatulaMedtr4g115920.2Medtr4g115920.1
Mimulus guttatusmgv1a004593mmgv1a006191m
Oryza sativaLOC_Os09g25580.1LOC_Os02g55910.2LOC_Os02g55910.1LOC_Os08g20420.1LOC_Os08g20420.2
Panicum virgatumPavirv00042978mPavirv00044523mPavirv00010348mPavirv00051656mPavirv00029899m
Pavirv00008414mPavirv00051657m
Physcomitrella patensPp1s33_287V6.1Pp1s20_66V6.1
Phaseolus vulgarisPhvul.001G042600.1Phvul.003G171300.1
Picea abiesMA_5461g0010
Populus trichocarpaPotri.018G016600.1Potri.006G063300.3Potri.006G063300.2Potri.006G063300.1Potri.018G123000.1
Potri.006G266500.2
Prunus persicappa003927mppa006453m
Ricinus communis29848.m00450927394.m000347
Setaria italicaSi029462mSi016983mSi015030m
Selaginella moellendorffii271007
Sorghum bicolorSb02g025070.1Sb04g036240.1Sb07g027910.1
Thellungiella halophilaThhalv10024883mThhalv10022676mThhalv10013431m
Vitis viniferaGSVIVT01035995001GSVIVT01012838001
Volvox carteriVocar20009507m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)