| Basic Information | |
|---|---|
| Species | Populus trichocarpa |
| Cazyme ID | Potri.008G073000.1 |
| Family | GH85 |
| Protein Properties | Length: 90 Molecular Weight: 10096.5 Isoelectric Point: 8.0688 |
| Chromosome | Chromosome/Scaffold: 08 Start: 4529399 End: 4530394 |
| Description | Glycosyl hydrolase family 85 |
| View CDS | |
| External Links |
|---|
| NCBI Taxonomy |
| Plaza |
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH85 | 1 | 65 | 1.5e-23 |
| MQGGYVNDKWVQGGTNPDAYATWHWYLIDVFVYFSHSLVTLPPPCWTNTAHRRGVKILFNFFWNC | |||
| Full Sequence |
|---|
| Protein Sequence Length: 90 Download |
| MQGGYVNDKW VQGGTNPDAY ATWHWYLIDV FVYFSHSLVT LPPPCWTNTA HRRGVKILFN 60 FFWNCPGGWF ALAGQATELA SCRGEGLRV* |
| Functional Domains Download unfiltered results here | ||||||
|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
| COG4724 | COG4724 | 0.0008 | 12 | 64 | 57 | + Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism] |
| cd06547 | GH85_ENGase | 5.0e-25 | 1 | 63 | 63 | + Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model. |
| pfam03644 | Glyco_hydro_85 | 3.0e-27 | 1 | 62 | 62 | + Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates. |
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0005737 | cytoplasm |
| GO:0033925 | mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | XP_002273683.1 | 4e-28 | 1 | 61 | 72 | 132 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002315137.1 | 2e-30 | 1 | 62 | 76 | 137 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002315138.1 | 1e-30 | 1 | 61 | 77 | 137 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002520781.1 | 3e-28 | 1 | 62 | 77 | 138 | endo beta n-acetylglucosaminidase, putative [Ricinus communis] |
| RefSeq | XP_002520784.1 | 4e-30 | 1 | 61 | 73 | 133 | endo beta n-acetylglucosaminidase, putative [Ricinus communis] |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| FC891120 | 61 | 1 | 61 | 3e-33 |
| DB892817 | 62 | 1 | 62 | 4e-32 |
| DY268779 | 61 | 1 | 61 | 6e-32 |
| HS567088 | 89 | 1 | 87 | 2e-31 |
| CO908115 | 62 | 1 | 62 | 3e-31 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |