CAZyme Information

Basic Information
SpeciesPopulus trichocarpa
Cazyme IDPotri.008G188200.2
FamilyCBM45
Protein PropertiesLength: 600 Molecular Weight: 68072.9 Isoelectric Point: 9.8389
ChromosomeChromosome/Scaffold: 08 Start: 13012573 End: 13016783
DescriptionPyruvate phosphate dikinase, PEP/pyruvate binding domain
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM451262019.9e-22
  LHWGAILDRKEKWVLPSRQPNGTTNYKNRALRSPFIKSGSNSYISIAIDDPATQAIEFLVVDEAKNKWFKDNGQNF
Full Sequence
Protein Sequence     Length: 600     Download
MSNSNIWHHK LFHYQSLLRP ASLEHRSKLD SSGIVAKYLF KAARRSSSFS GNDLKLRRSE    60
SGIGGSRRSV IFTPRAVLAM EPSSELAGKF NLDGNIEMQV FVSNSSAASI AQINIQITYS    120
SDSLLLHWGA ILDRKEKWVL PSRQPNGTTN YKNRALRSPF IKSGSNSYIS IAIDDPATQA    180
IEFLVVDEAK NKWFKDNGQN FHIKLPMREK LIIPNVSVPE ELVQIQAYLR WERKGKQMYT    240
PEQEKEEYES ARFELLEEVA RGTSIEDLRA KLTNKNDRCE IKEPSVSKIK NRIPDDLVQI    300
QAYIRWEKAG KPNYSPEQQL REFEKAREEL QTELYKGVSI DEIQKKITKG EIKTEESKQL    360
QNKRYFSNER IQRKKWDIMQ LVNKHAAKSV EDKVSKSAEG KASVESKVLK AVELFAKKKE    420
EHDGGAVLNK KIFKLADKEL LVLVTKPGGK VKVHLATDLE QPVTLHWALS KKAGEWLEPP    480
PNVLPPGSIS LQVAAETQLK NESSTEFSYQ VQSFEMEIEK DTFIGMPFVL LSNGRWIKNN    540
GSDFYIEFGR GSKHVQKDAG DGIGTARALL DKIAKMESEA QKSFMHRSVK CLCIHIFSC*    600

Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02784PLN027840.00112320692+
PLN02784PLN027846.0e-612420686+
PLN02784PLN027842.0e-7411583185+
PLN02784PLN027841.0e-9448567123+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK11735.101458711580starch associated protein R1 [Solanum tuberosum]
Swiss-ProtQ8LPT9015871588GWD1_CITRE RecName: Full=Alpha-glucan water dikinase, chloroplastic; AltName: Full=Starch-related protein R1; Flags: Precursor
RefSeqXP_002270485.1045872584PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315679.1015871593predicted protein [Populus trichocarpa]
RefSeqXP_002527902.1045872584alpha-glucan water dikinase, chloroplast precursor, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IIRXN-12203EC-2.7.9.4α-glucan, water dikinase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7799573641945570
HO800258339243620
HO779957742693400.00000002
HO7799571121182200.00007
HO779957315575870.0004
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00059.2.125.200Aquca_002_00059.2.125.200Aquca_002_00059.1.125.200Aquca_002_00059.1.125.200Aquca_010_00076.4
Aquca_010_00076.3Aquca_010_00076.2Aquca_010_00076.1Aquca_002_00499.4.322.398Aquca_002_00499.4.322.398
Aquca_002_00499.3.322.398Aquca_002_00499.3.322.398Aquca_002_00499.2.322.398Aquca_002_00499.2.322.398Aquca_002_00499.1.322.398
Aquca_002_00499.1.322.398Aquca_002_00059.3Aquca_002_00059.2.379.458Aquca_002_00059.2.379.458Aquca_002_00059.1.379.458
Aquca_002_00059.1.379.458Aquca_002_00499.4.126.212Aquca_002_00499.4.126.212Aquca_002_00499.3.126.212Aquca_002_00499.3.126.212
Aquca_002_00499.2.126.212Aquca_002_00499.2.126.212Aquca_002_00499.1.126.212Aquca_002_00499.1.126.212
Arabidopsis lyrata888368.117.192888368.117.192339218.127.210888368.391.469888368.391.469
492401
Arabidopsis thalianaAT1G10760.1.120.195AT1G10760.1.120.195AT1G69830.1.305.381AT1G69830.1.305.381AT1G69830.1.126.209
AT1G69830.1.126.209AT1G10760.1.394.472AT1G10760.1.394.472AT4G24450.1
Brachypodium distachyonBradi1g41907.2.109.184Bradi1g41907.2.109.184Bradi1g41907.1.109.184Bradi1g41907.1.109.184Bradi3g11270.1
Bradi2g48150.1.119.204Bradi2g48150.1.119.204Bradi1g41907.2.447.524Bradi1g41907.2.447.524Bradi1g41907.1.447.524
Bradi1g41907.1.447.524Bradi2g48150.1.299.375Bradi2g48150.1.299.375
Brassica rapaBra031749Bra018423.116.191Bra018423.116.191Bra016262.314.390Bra016262.314.390
Bra016262.127.210Bra016262.127.210Bra018423.389.467Bra018423.389.467Bra013803
Carica papayaevm.model.supercontig_69.90evm.model.supercontig_5.271.119.202
Capsella rubellaCarubv10008131mCarubv10019759m.318.394Carubv10019759m.318.394Carubv10019759m.133.214Carubv10019759m.133.214
Carubv10006877m
Citrus clementinaCiclev10030521mCiclev10030520mCiclev10030501mCiclev10030500mCiclev10030499m
Ciclev10030780m.171.247Ciclev10030661m.319.395Ciclev10030661m.319.395Ciclev10017434mCiclev10030661m.128.211
Ciclev10030661m.128.211
Citrus sinensisorange1.1g006158m.75.151orange1.1g004353m.317.393orange1.1g004353m.317.393orange1.1g003698m.219.295orange1.1g003698m.219.295
orange1.1g003613m.317.393orange1.1g003613m.317.393orange1.1g003004m.317.393orange1.1g003004m.317.393orange1.1g002611m.317.393
orange1.1g002611m.317.393orange1.1g002585m.317.393orange1.1g002585m.317.393orange1.1g001903morange1.1g001677m
orange1.1g001333morange1.1g001268morange1.1g001019morange1.1g004353m.126.209orange1.1g004353m.126.209
orange1.1g003698m.28.111orange1.1g003698m.28.111orange1.1g003613m.126.209orange1.1g003613m.126.209orange1.1g003004m.126.209
orange1.1g003004m.126.209orange1.1g002611m.126.209orange1.1g002611m.126.209orange1.1g002585m.126.209orange1.1g002585m.126.209
Cucumis sativusCucsa.286300.3Cucsa.286300.2Cucsa.286300.1Cucsa.285330.2.172.248Cucsa.285330.1.312.388
Cucsa.285330.1.312.388Cucsa.285330.1.120.205Cucsa.285330.1.120.205
Eucalyptus grandisEucgr.H02531.2.128.203Eucgr.H02531.2.128.203Eucgr.H02531.1.128.203Eucgr.H02531.1.128.203Eucgr.G02543.2.332.409
Eucgr.G02543.2.332.409Eucgr.G02543.1.332.409Eucgr.G02543.1.332.409Eucgr.H02531.2.459.539Eucgr.H02531.2.459.539
Eucgr.H02531.1.459.539Eucgr.H02531.1.459.539Eucgr.G02543.2.138.224Eucgr.G02543.2.138.224Eucgr.G02543.1.138.224
Eucgr.G02543.1.138.224
Fragaria vescamrna03581.1-v1.0-hybrid
Glycine maxGlyma08g39110.2.123.198Glyma08g39110.2.123.198Glyma08g39110.1.123.198Glyma08g39110.1.123.198Glyma18g20600.2.123.198
Glyma18g20600.2.123.198Glyma02g02450.1.313.389Glyma02g02450.1.313.389Glyma08g39110.2.452.531Glyma08g39110.2.452.531
Glyma08g39110.1.452.531Glyma08g39110.1.452.531Glyma18g20600.2.452.531Glyma18g20600.2.452.531Glyma08g40810.1.133.219
Glyma08g40810.1.133.219Glyma08g40810.1.327.403Glyma08g40810.1.327.403Glyma04g10375.2Glyma04g10375.1
Glyma02g02450.1.120.206Glyma02g02450.1.120.206
Gossypium raimondiiGorai.002G186200.7.135.210Gorai.002G186200.7.135.210Gorai.002G186200.6.121.196Gorai.002G186200.6.121.196Gorai.002G186200.5.135.210
Gorai.002G186200.5.135.210Gorai.002G186200.4.135.210Gorai.002G186200.4.135.210Gorai.002G186200.3.135.210Gorai.002G186200.3.135.210
Gorai.002G186200.2.135.210Gorai.002G186200.2.135.210Gorai.002G186200.1.136.211Gorai.002G186200.1.136.211Gorai.008G160400.2
Gorai.008G160400.1Gorai.002G186200.8Gorai.002G186200.7.465.544Gorai.002G186200.7.465.544Gorai.002G186200.6.451.530
Gorai.002G186200.6.451.530Gorai.002G186200.5.465.544Gorai.002G186200.5.465.544Gorai.002G186200.4.465.544Gorai.002G186200.4.465.544
Gorai.002G186200.3.465.544Gorai.002G186200.3.465.544Gorai.002G186200.2.465.544Gorai.002G186200.2.465.544Gorai.002G186200.1.466.545
Gorai.002G186200.1.466.545Gorai.008G182600.7Gorai.008G182600.6.125.208Gorai.008G182600.5.125.208Gorai.008G182600.4.125.208
Gorai.008G182600.3.123.206Gorai.008G182600.2.125.208Gorai.008G182600.1.125.208
Linum usitatissimumLus10013044.135.210Lus10013044.135.210Lus10029118.135.210Lus10029118.135.210Lus10036717.126.209
Lus10036717.126.209Lus10030793.133.216Lus10030793.133.216Lus10013270.136.219Lus10013270.136.219
Lus10037211.126.209Lus10037211.126.209Lus10030793.315.391Lus10030793.315.391Lus10013270.318.394
Lus10013270.318.394Lus10037211.305.381Lus10037211.305.381Lus10036717.305.381Lus10036717.305.381
Lus10029118.445.523Lus10029118.445.523Lus10013044.463.541Lus10013044.463.541Lus10032829
Malus domesticaMDP0000252405.192.267MDP0000252405.192.267MDP0000951961.54.127MDP0000951961.54.127MDP0000951961.323.402
MDP0000951961.323.402MDP0000252405.478.557MDP0000252405.478.557
Manihot esculentacassava4.1_000266m.133.208cassava4.1_000266m.133.208cassava4.1_004613m.310.386cassava4.1_004613m.310.386cassava4.1_000266m.404.482
cassava4.1_000266m.404.482cassava4.1_004613m.121.204cassava4.1_004613m.121.204cassava4.1_001555m.120.203cassava4.1_001362m.120.203
Mimulus guttatusmgv1a000186mmgv1a000185mmgv1a001104m.306.382mgv1a001104m.306.382mgv1a001104m.125.211
mgv1a001104m.125.211
Oryza sativaLOC_Os01g51754.4LOC_Os01g51754.3
Panicum virgatumPavirv00036852m.113.188Pavirv00036852m.113.188Pavirv00030888m.120.203Pavirv00030888m.120.203Pavirv00061832m.120.203
Pavirv00061832m.120.203Pavirv00036852m.456.533Pavirv00036852m.456.533Pavirv00061832m.304.382Pavirv00061832m.304.382
Pavirv00030888m.304.382Pavirv00030888m.304.382
Phaseolus vulgarisPhvul.003G062900.1.120.195Phvul.003G062900.1.120.195Phvul.002G065700.1.313.389Phvul.002G065700.1.313.389Phvul.003G062900.1.449.528
Phvul.003G062900.1.449.528Phvul.003G069200.1.132.218Phvul.003G069200.1.132.218Phvul.003G069200.1.326.402Phvul.003G069200.1.326.402
Phvul.002G065700.1.119.205Phvul.002G065700.1.119.205
Picea abiesMA_50250g0010MA_108710g0010MA_72129g0020
Populus trichocarpaPotri.010G044100.4.130.205Potri.010G044100.4.130.205Potri.010G044100.3Potri.010G044100.2Potri.010G044100.1
Potri.008G188200.1Potri.010G092900.9.140.223Potri.010G092900.9.140.223Potri.010G092900.8.140.223Potri.010G092900.8.140.223
Potri.010G092900.6.140.223Potri.010G092900.6.140.223Potri.010G092900.5.140.223Potri.010G092900.5.140.223Potri.010G092900.4.140.223
Potri.010G092900.4.140.223Potri.010G092900.3.140.223Potri.010G092900.3.140.223Potri.010G092900.2.140.223Potri.010G092900.2.140.223
Potri.010G092900.1.140.223Potri.010G092900.1.140.223Potri.010G092900.9.331.407Potri.010G092900.9.331.407Potri.010G092900.8.331.407
Potri.010G092900.8.331.407Potri.010G092900.6.331.407Potri.010G092900.6.331.407Potri.010G092900.5.320.396Potri.010G092900.5.320.396
Potri.010G092900.4.316.392Potri.010G092900.4.316.392Potri.010G092900.3.331.407Potri.010G092900.3.331.407Potri.010G092900.2.327.403
Potri.010G092900.2.327.403Potri.010G092900.1.331.407Potri.010G092900.1.331.407Potri.010G044100.4.469.548Potri.010G044100.4.469.548
Prunus persicappa000209m.127.202ppa000209m.127.202ppa001575m.213.289ppa000209m.462.540ppa000209m.462.540
Ricinus communis27504.m000617.131.20627504.m000617.131.20629736.m002033.124.20729736.m002033.124.20729736.m002033.313.389
29736.m002033.313.38927504.m000617.462.54127504.m000617.462.541
Setaria italicaSi005690m.113.188Si005690m.113.188Si000308m.120.203Si000308m.120.203Si000258m.120.203
Si000258m.120.203Si005690m.456.533Si005690m.456.533Si000308m.304.382Si000308m.304.382
Si000258m.304.382Si000258m.304.382
Sorghum bicolorSb10g017820.1.117.192Sb10g017820.1.117.192Sb03g032830.1.58.143Sb03g032830.1.58.143Sb10g017820.1.460.537
Sb10g017820.1.460.537Sb03g032830.1.241.319Sb03g032830.1.241.319
Thellungiella halophilaThhalv10006578mThhalv10006565mThhalv10018099m.133.216Thhalv10018099m.133.216Thhalv10018099m.318.394
Thhalv10018099m.318.394Thhalv10024230m
Vitis viniferaGSVIVT01013806001GSVIVT01020069001.305.381GSVIVT01020069001.305.381GSVIVT01020069001.117.203GSVIVT01020069001.117.203
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)