Basic Information | |
---|---|
Species | Populus trichocarpa |
Cazyme ID | Potri.009G044400.2 |
Family | AA6 |
Protein Properties | Length: 167 Molecular Weight: 17907.3 Isoelectric Point: 5.1734 |
Chromosome | Chromosome/Scaffold: 09 Start: 5082317 End: 5085665 |
Description | Quinone reductase family protein |
View CDS |
External Links |
---|
NCBI Taxonomy |
Plaza |
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA6 | 2 | 163 | 0 |
EQVPETLSNSILNKVKANPKADDVPVILPEQLLEADGFLFGFPSRFGVMASQFKAFFDATHELWATQALAGKPAGFFWSTGFYGGGQELAAFTAITQLAH HGMLFVPLGYTFGSGMFEMGEVKGGSSYGAGTFAADGSRQPSELELQQAFYQGKYVSEITKK |
Full Sequence |
---|
Protein Sequence Length: 167 Download |
MEQVPETLSN SILNKVKANP KADDVPVILP EQLLEADGFL FGFPSRFGVM ASQFKAFFDA 60 THELWATQAL AGKPAGFFWS TGFYGGGQEL AAFTAITQLA HHGMLFVPLG YTFGSGMFEM 120 GEVKGGSSYG AGTFAADGSR QPSELELQQA FYQGKYVSEI TKKLKG* |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam03358 | FMN_red | 4.0e-11 | 15 | 111 | 97 | + NADPH-dependent FMN reductase. | ||
COG0655 | WrbA | 4.0e-32 | 23 | 166 | 145 | + Multimeric flavodoxin WrbA [General function prediction only] | ||
TIGR01755 | flav_wrbA | 3.0e-45 | 1 | 164 | 166 | + NAD(P)H:quinone oxidoreductase, type IV. This model represents a protein, WrbA, related to and slightly larger than flavodoxin. It was just shown, in E. coli and Archaeoglobus fulgidus (and previously for some eukaryotic homologs) to act as fourth type of NAD(P)H:quinone oxidoreductase. In E. coli, this protein was earlier reported to be produced during stationary phase, bind to the trp repressor, and make trp operon repression more efficient. WrbA does not interact with the trp operator by itself. Members are found in species in which homologs of the E. coli trp operon repressor TrpR are not detected [Energy metabolism, Electron transport]. | ||
PRK03767 | PRK03767 | 2.0e-55 | 3 | 166 | 167 | + NAD(P)H:quinone oxidoreductase; Provisional |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABD98056.1 | 0 | 3 | 165 | 39 | 201 | quinone-oxidoreductase QR2 [Striga asiatica] |
RefSeq | NP_200688.2 | 0 | 3 | 165 | 40 | 202 | quinone reductase family protein [Arabidopsis thaliana] |
RefSeq | XP_002279688.1 | 0 | 3 | 165 | 40 | 202 | PREDICTED: hypothetical protein isoform 2 [Vitis vinifera] |
RefSeq | XP_002314113.1 | 0 | 3 | 166 | 40 | 203 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002525624.1 | 0 | 3 | 166 | 40 | 203 | Flavoprotein wrbA, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 4dy4_C | 3e-40 | 1 | 166 | 35 | 197 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 4dy4_A | 3e-40 | 1 | 166 | 35 | 197 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6m_B | 3e-40 | 1 | 166 | 36 | 198 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6m_A | 3e-40 | 1 | 166 | 36 | 198 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
PDB | 3b6k_B | 3e-40 | 1 | 166 | 36 | 198 | A Chain A, High Resolution Structure Of E.coli Wrba With Fmn |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
CV242353 | 165 | 3 | 167 | 0 |
CN523862 | 165 | 3 | 167 | 0 |
DN619291 | 163 | 3 | 165 | 0 |
GD113594 | 163 | 3 | 165 | 0 |
CX289758 | 162 | 3 | 164 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|